KEGG   Rhodococcus fascians: A3L23_04478Help
Entry
A3L23_04478       CDS       T04328                                 

Gene name
ppgK
Definition
(GenBank) Polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
rfa  Rhodococcus fascians
Pathway
rfa00010  Glycolysis / Gluconeogenesis
rfa00520  Amino sugar and nucleotide sugar metabolism
rfa01100  Metabolic pathways
rfa01110  Biosynthesis of secondary metabolites
rfa01120  Microbial metabolism in diverse environments
rfa01130  Biosynthesis of antibiotics
rfa01200  Carbon metabolism
Module
rfa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rfa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A3L23_04478 (ppgK)
   00520 Amino sugar and nucleotide sugar metabolism
    A3L23_04478 (ppgK)
Enzymes [BR:rfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     A3L23_04478 (ppgK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AMY55781
UniProt: A0A165N0I8
LinkDB All DBs
Position
4733701..4734525
Genome map
AA seq 274 aa AA seqDB search
MTQPGSDNSTAATAERHGFGVDVGGSGIKGGIVDLNTGELVGDRYKIETPQPSTPDAVAR
TVAEIVAHFEWTGPIGVTLPAVVTNGVARSAANIDKSWIDTDARALFAKAIGNENITVLN
DADAAGVAEDKYGGGKGKDGVVVLLTFGTGIGSAVLHNGVLLPNTEFGHMEIGGKEAEHR
AASSVKENKGLSYKEWAKEVSTVLATFEALLWPDLFIAGGGISRKSEKWIPHLTNRTPVV
PATLLNTAGIVGAALAADSAVASAETGTSAGSPH
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgacacagccaggttcggacaacagcaccgcggcgacggccgagcgtcacgggttcggc
gtcgacgtcggtggcagcggcatcaagggcggcatcgtcgacctgaacaccggtgagctc
gtgggcgatcgctacaagatcgagacgcctcagccctcgacccccgacgccgtcgcgcgg
accgtggccgagatcgtcgcgcatttcgagtggaccggaccgatcggcgtcaccctgccc
gcggtggtcaccaacggtgtggctcgttcggccgccaacatcgacaagagctggatcgac
acggatgcgcgcgcactgttcgcgaaggccatcggaaacgagaacatcaccgtcctcaac
gacgcagatgccgctggggtcgccgaggacaagtacggcggcggtaagggcaaggacggg
gtcgtcgttctgctcacgttcggcaccggcatcggttccgccgttctgcacaacggagtt
ctgctgccgaacaccgagttcggacacatggagatcggtggcaaggaagccgagcatcgc
gcggcgtcctcggtgaaggagaacaaggggctgtcctacaaggaatgggccaaagaggtc
tccaccgtgctcgcaacgttcgaggcgctgctgtggcccgacctgttcatcgccggtggc
ggaatcagtcgcaagagcgagaagtggattccgcacctgaccaaccgaactccggtggtc
cccgcgaccctgctgaacacggcggggatcgtcggagcggccctcgctgcggacagtgcc
gtcgcgtccgccgagaccggtacatcggctggatcaccgcactga

DBGET integrated database retrieval system