KEGG   Rickettsia felis: RF_1130Help
Entry
RF_1130           CDS       T00252                                 

Gene name
gatB
Definition
(GenBank) Glutamyl-tRNA(Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
rfe  Rickettsia felis
Pathway
rfe00970  Aminoacyl-tRNA biosynthesis
rfe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rfe00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    RF_1130 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rfe03029]
    RF_1130 (gatB)
Enzymes [BR:rfe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     RF_1130 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     RF_1130 (gatB)
Mitochondrial biogenesis [BR:rfe03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    RF_1130 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AAY61981
UniProt: Q4UKF0
LinkDB All DBs
Position
1197989..1199440
Genome map
AA seq 483 aa AA seqDB search
MAYIEGNTGKWEYIIGLEIHAQISSKSKLFSGSSTIFAANPNSQVSYVDAAMPGMLPVLN
KHCVYQAIKTGLGLKAKINKYSVFDRKNYFYADLPQGYQISQFYYPIVQNGTMEIPTSTG
DLKTIRINRLHLEQDAGKSMHDQSPHYSFIDLNRAGIGLMEIVTEPDISSPDEAAEFVKK
LRNLLRYIGSCDGDMEKGSMRCDANISVRRSGEPLGTRCEIKNINSIRNIIKAIEFEAKR
QVDLLENGEAIIQETRLFNADSGETKTMRLKEEALDYRYFPDPDLLPLVISDELINELKA
NLPELPDQKIEKYTKEFGLSKYDAEVIVADESVAEYFEKAANECNPKMLTNWLTSELFGQ
LNKASIGINECKITPSNFAKLVKLIENDTISGKIAKTVFEIMFETGKAPDKIVEEKGLVQ
VSDNNVLNTVIDEVIAENPESVEGYKRGKDKLFGFFVGQVMKKTGGKANPTLVNQLLKDK
LDS
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggcatatattgaaggtaatacgggaaaatgggaatatataatagggcttgaaatccat
gctcaaatttcctcaaaatctaagcttttttcaggaagtagtactatttttgcagcaaat
ccaaattcgcaggtttcctatgttgatgcagcaatgcccgggatgttaccggtattaaat
aagcattgcgtataccaagcaattaaaacagggcttgggcttaaagctaaaataaataaa
tattcggtatttgatcgtaaaaattatttttatgctgatctgccccaaggttaccaaatc
tcgcaattttactatcctatagtgcaaaacggaactatggaaataccgactagtaccggc
gatcttaaaactattcgcattaaccgtttgcatttagagcaggatgcgggtaaatctatg
catgatcaatcaccacattacagctttatcgatttaaatcgtgccggtattggacttatg
gaaattgtgaccgaacctgatatatcatcacctgatgaagctgctgaatttgtaaaaaag
ctgagaaatttgctacgttatatcggcagctgcgacggtgatatggaaaaaggctcaatg
cgttgcgatgctaatatttcagtacgacgtagcggtgaaccactcggcacaagatgcgaa
attaaaaatattaattcaattcgtaatattattaaagcaatagaatttgaagctaaaaga
caagtagacttgcttgaaaacggtgaagcaataattcaagaaacacgcttatttaatgcc
gatagcggtgaaacaaaaactatgcgtttaaaagaagaagcacttgattatagatatttt
cctgatcctgatttattaccgcttgttatttctgatgagttaataaatgaactaaaagca
aacttacctgagctacctgatcaaaagattgaaaaatatacgaaagaatttggcttaagt
aaatatgatgccgaagtaatagtagccgatgaatcggttgctgagtattttgagaaagca
gcaaatgaatgtaaccctaaaatgcttactaattggctaactagtgagttgttcggacaa
ttaaacaaagcatcgataggaataaatgaatgtaaaattactcctagtaactttgcaaaa
ctggtaaaattaatagaaaatgatactatttctggtaaaattgcaaaaaccgtttttgaa
attatgtttgaaaccggtaaagcacctgataaaatagtagaggaaaaaggacttgtacaa
gtttcggataataacgtgctgaacacagtaattgacgaggtaatagctgaaaatcctgaa
tcagtagagggttataaaagaggtaaggataaattattcggtttctttgtaggccaggtg
atgaaaaaaaccggcggtaaggctaatccgacccttgtgaatcagcttttaaaggataag
ctggattcttga

DBGET integrated database retrieval system