KEGG   Rickettsia felis: RF_1159Help
Entry
RF_1159           CDS       T00252                                 

Gene name
sdhA
Definition
(GenBank) Succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
rfe  Rickettsia felis
Pathway
rfe00020  Citrate cycle (TCA cycle)
rfe00190  Oxidative phosphorylation
rfe00650  Butanoate metabolism
rfe01100  Metabolic pathways
rfe01110  Biosynthesis of secondary metabolites
rfe01120  Microbial metabolism in diverse environments
rfe01130  Biosynthesis of antibiotics
rfe01200  Carbon metabolism
Module
rfe_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rfe_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rfe_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rfe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RF_1159 (sdhA)
   00650 Butanoate metabolism
    RF_1159 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    RF_1159 (sdhA)
Enzymes [BR:rfe01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     RF_1159 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     RF_1159 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 DAO FAD_binding_3 HI0933_like Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AAY62010
UniProt: Q4UJM1
LinkDB All DBs
Position
complement(1232807..1234597)
Genome map
AA seq 596 aa AA seqDB search
MTKAYNIIHHKFDVVVVGAGGAGLRSAFGMAKEGLNTACITKLFPTRSHTVAAQGGISAA
LGNMGEDDWRWHMYDTVKGSDWLGDQDAIEYMCKNAPDAILELEHYGVPFSRTEEGKIYQ
RPFGGMTTEYGKGKAAQRTCAAADRTGHAILHTLYQQSLKHKVQFFVEYFAIDLLMEDGE
CRGVVVWNLDDGTLHCFRAHNVVLATGGYGRAYFSATSAHTCTGDGGGMAIRAGLPLQDM
EFVQFHPTGIYSAGCLITEGARGEGGYLVNANGERFMERYAPAAKDLASRDVVSRAMTIE
IREGRGVGEHKDHVFLHLNHLSPEILHSRLPGISETAKIFAGVDVTKEPIPVLPTVHYNM
GGIPTNYHGQVIIKDGTNHNSVVKGLMAIGEAACVSVHGANRLGSNSLLDLVVFGRSSAL
KAAELISPASPHKPIKEASLEKIINRFDKVRHANGNILVADLRLKMQRTMQSHASVFRTQ
EVLDEGAGMISEIRNGYKDIKINDKSLIWNSDLVEALELDNLLDQALVTVYSAAARKESR
GAHAREDYPDRNDGDWMKHTLSSIDEAGKIVIDYKPVTLTTLTDEISAIPPAKRVY
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgactaaagcatataatatcattcatcataaatttgacgtagtagttgtaggtgcaggc
ggagcaggtcttcgttctgcattcggtatggctaaagaagggctaaataccgcctgtata
actaagctatttccgactcgtagtcatactgtggctgcacaaggcggaatcagtgcagca
cttgggaatatgggcgaagatgattggcgttggcatatgtatgatactgttaaaggctct
gattggttaggtgatcaggatgctatcgagtatatgtgcaagaacgctcctgatgcgatt
ttagagctagagcattacggcgtacctttctcaagaaccgaagagggaaagatttatcaa
cgtccttttggaggaatgactacggagtacggtaaaggaaaagcggctcagcgtacatgt
gctgcggcagatcgcacggggcatgccatacttcatacgttatatcagcagtcactaaag
cataaagtacagtttttcgttgagtattttgctattgatttattgatggaagatggtgaa
tgtagaggcgtagttgtgtggaatttagacgatggtactctgcattgttttagagctcat
aatgtagtgcttgcaacgggcggatacgggcgtgcttatttttcagcaacgtctgctcat
acttgtacgggtgacgggggcggtatggcgattagagcaggtttgccgctgcaagatatg
gagtttgtacagttccacccgaccggtatatattctgccggttgtctcattaccgaggga
gcaagaggtgaaggtggatatctcgttaatgcaaacggagagcgttttatggagcgttac
gctccagccgcaaaggatttagcttcaagagacgtagtttcaagagcgatgactatcgag
attcgtgaagggcgaggagtcggcgagcataaagatcacgtatttctgcatttaaatcat
ttatcgcctgaaattttacacagccgtttgcccggtatctctgagacggctaaaattttt
gccggtgttgatgtcactaaagagccgataccggtacttcctacagttcattataatatg
ggcgggataccgactaattaccacggtcaagtaattattaaagacggcactaatcataat
agcgtagtaaaaggtcttatggcaattggtgaagcggcttgcgtatcggtacacggtgct
aatcgattaggttcaaactctttacttgatttagtagtattcggtagaagtagtgcttta
aaagcagctgagcttattagtccagcgagtccccataagcctataaaagaggcaagtctt
gaaaaaattataaatagatttgataaagtccgtcacgctaacggtaatattttagttgca
gatttaaggcttaaaatgcaaagaactatgcaaagccacgcttcggtatttagaactcaa
gaagtactagatgaaggagcaggaatgattagcgaaataagaaacggctataaagatata
aaaattaacgataaatctttaatttggaatagtgatttagtggaggctttagagctagat
aatctacttgatcaggccttggtgacagtatattcggcagctgcaagaaaagaaagcaga
ggtgctcatgctagggaagattatcctgatcgtaatgatggagattggatgaagcatact
cttagctctatcgatgaagcaggtaaaatagttattgattataaacctgtaacgctaacc
actttaaccgatgagataagtgcaattccaccggccaagagggtgtattaa

DBGET integrated database retrieval system