KEGG   Reinekea forsetii: REIFOR_00398Help
Entry
REIFOR_00398      CDS       T05208                                 

Definition
(GenBank) anthranilate synthase, aminase component
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
rfo  Reinekea forsetii
Pathway
rfo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rfo01100  Metabolic pathways
rfo01110  Biosynthesis of secondary metabolites
rfo01130  Biosynthesis of antibiotics
rfo01230  Biosynthesis of amino acids
rfo02024  Quorum sensing
Module
rfo_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rfo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    REIFOR_00398
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    REIFOR_00398
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    REIFOR_00398
Enzymes [BR:rfo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     REIFOR_00398
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N
Motif
Other DBs
NCBI-ProteinID: ATX75573
UniProt: A0A2K8KKT3
LinkDB All DBs
Position
complement(411417..412805)
Genome map
AA seq 462 aa AA seqDB search
MVQPLKFTLPRKPQYLKVADHCDFFELFKKVDKAYDNCFILESLGEDSHIARHSIIGFDP
EKVIFANGDQLTITERDGSQVHYQSDNPYELLRTLMPQDIISRMYAGGLTGYLGYDAMNY
FEAKLDIQTSELFDAFRFGLYKDGLVCDKMTGEVFYFYYDNNRIDRVTQLLASSYPGNGP
LTVTATGDSMSREQHRAAVLKVKQDIIDGKIFQTEVGFKKYFSLDGDTINLYEKLRDVNP
SPQMYYVKFGAQKLIGASPELLFRLRQGEMETFPLAGTTLRGTTPEGDTLLARALLNDPK
EIAEHNMIVDLHRNDIGRVARFGTVKVRSLMDIKRFSHVQHISSEIVGIIAEQEDMFSAL
ASNFPAGTLTGAPKIEAMKIINDLESDGRGPYGGAVGHFSFNGDCTFAIPIRTIFANGDQ
AYVQTCGGNVYDSNPDDEYEEIQRKFAGTRKVLEQFMTPEPS
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaaccgttaaaatttaccctgccgcgcaagccgcaatatctcaaggtcgccgac
cactgcgatttctttgaactgttcaaaaaagtcgataaggcctatgacaactgttttatt
ctcgaatcgctcggtgaggacagccatatcgcccggcacagcattattggcttcgacccc
gaaaaggtgatcttcgccaatggcgatcaactaaccattaccgagcgcgacggctcccag
gtccattatcagagtgacaatccatatgagctgctgcgcacgctgatgccacaggatatt
atttcgcgcatgtacgccggcggcctgaccggctacttgggttacgatgcgatgaactat
tttgaagccaagctcgatattcaaaccagtgagctgttcgatgccttccgttttggcctc
tataaggacggcctggtgtgcgacaagatgaccggggaggtgttctatttttattacgac
aacaaccgcatcgatcgggtgacgcaattgcttgccagcagctacccaggcaatggcccc
ttgacggtcacggccaccggcgacagcatgtcacgcgaacagcatcgcgccgccgtgctc
aaggttaagcaagacataatcgatggcaaaatcttccaaaccgaggtcgggttcaagaag
tatttcagcctggatggcgacaccatcaacctctatgaaaaactgcgcgacgtgaacccc
tcgccgcagatgtactacgttaagtttggcgcccaaaaactgatcggggccagcccagaa
ctgctgttccgtctgcgtcaaggtgaaatggagacctttccgttggccggcaccaccctg
cgcggcacgacgccggaaggcgacaccctgctcgcgcgcgccttattgaacgatcccaaa
gagatcgccgagcacaatatgattgtcgatctgcaccgcaacgatattggccgggtggca
cgctttggcaccgtcaaggtgcgcagtctgatggacatcaaacgtttcagccatgtgcag
cacatctccagtgagatcgtcggcattatcgccgagcaagaggatatgttcagcgccttg
gcgagcaactttccggccggcaccctaaccggggcaccgaagattgaggcgatgaaaatc
atcaacgacctggagtccgacggacgcggtccctacggtggcgcggtcgggcacttttct
ttcaatggcgactgcacctttgctattcccattcgcaccatcttcgccaatggcgaccag
gcttatgtgcaaacctgcggcggcaatgtgtacgactccaaccccgacgatgagtacgaa
gaaattcaacgcaagtttgccggcacgcgcaaggtcttggagcaatttatgacgcccgag
ccaagctaa

DBGET integrated database retrieval system