KEGG   Reinekea forsetii: REIFOR_00494Help
Entry
REIFOR_00494      CDS       T05208                                 

Definition
(GenBank) shikimate kinase I
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
rfo  Reinekea forsetii
Pathway
rfo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rfo01100  Metabolic pathways
rfo01110  Biosynthesis of secondary metabolites
rfo01130  Biosynthesis of antibiotics
rfo01230  Biosynthesis of amino acids
Module
rfo_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:rfo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    REIFOR_00494
Enzymes [BR:rfo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     REIFOR_00494
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_33 AAA_17 Cytidylate_kin2 Cytidylate_kin
Motif
Other DBs
NCBI-ProteinID: ATX75664
UniProt: A0A2K8KQT9
LinkDB All DBs
Position
518775..519257
Genome map
AA seq 160 aa AA seqDB search
MGAGKSTIGRLLSEQLALEFVDLDRLIEERAGASIAWIFDIEGEEGFRERETQSLEFILD
TPAQIIATGGGCILRPENRNMLAMSDRIIYLETSIEQQLERTAKDKNRPLLQNGNPEPVL
VAMAALRNPLYQQSGRLTVDTNGKPPKLVVHEILNFLDEI
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcgggcaaaagcaccattggccggctattatcagaacagttggcgctcgaattt
gtcgacctggatcggctcatcgaagagcgagccggagcctctattgcctggatatttgat
attgaaggtgaagaagggtttcgtgagcgcgaaactcagtctctggaatttatcctcgat
acccctgcgcagatcatcgccaccggcggtggctgtatattgcggccggaaaatcgcaac
atgttggcgatgtccgatcgaatcatctatctagagacgtcgatcgagcaacaattggag
cggaccgcaaaagataaaaaccggcccctcttgcagaacggcaatcctgaacccgtgttg
gtggcgatggcggcactgcgcaatccgctctatcaacagagtggccgtttgacggtcgac
actaatggcaagccgcccaagctggtggtccacgaaattctcaattttctagatgaaatc
taa

DBGET integrated database retrieval system