KEGG   Reinekea forsetii: REIFOR_01555Help
Entry
REIFOR_01555      CDS       T05208                                 

Definition
(GenBank) enoyl-CoA hydratase / delta-cis-delta(2)-trans-enoyl-CoA isomerase / 3-hydroxyacyl-CoA dehydrogenase
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
rfo  Reinekea forsetii
Pathway
rfo00071  Fatty acid degradation
rfo00280  Valine, leucine and isoleucine degradation
rfo00281  Geraniol degradation
rfo00310  Lysine degradation
rfo00362  Benzoate degradation
rfo00380  Tryptophan metabolism
rfo00410  beta-Alanine metabolism
rfo00640  Propanoate metabolism
rfo00650  Butanoate metabolism
rfo00903  Limonene and pinene degradation
rfo00930  Caprolactam degradation
rfo01100  Metabolic pathways
rfo01110  Biosynthesis of secondary metabolites
rfo01120  Microbial metabolism in diverse environments
rfo01130  Biosynthesis of antibiotics
rfo01200  Carbon metabolism
rfo01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rfo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    REIFOR_01555
   00650 Butanoate metabolism
    REIFOR_01555
  09103 Lipid metabolism
   00071 Fatty acid degradation
    REIFOR_01555
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    REIFOR_01555
   00310 Lysine degradation
    REIFOR_01555
   00380 Tryptophan metabolism
    REIFOR_01555
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    REIFOR_01555
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    REIFOR_01555
   00281 Geraniol degradation
    REIFOR_01555
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    REIFOR_01555
   00930 Caprolactam degradation
    REIFOR_01555
Enzymes [BR:rfo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     REIFOR_01555
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     REIFOR_01555
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     REIFOR_01555
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     REIFOR_01555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: ATX76700
UniProt: A0A2K8KPK2
LinkDB All DBs
Position
1669989..1672136
Genome map
AA seq 715 aa AA seqDB search
MIYQGKNITVTSLAGDLAELVFDLAGESVNKFDQLTLAELGAATEHMRAAKLKGLLVTSA
KQSFIVGADINEFQQWFEQDEAGIIVDVLKANAIFSAFEDLPFPTVVAINGICLGGGMEM
ALACDYRLMSTQAKVGLPEVKLGLFPGFGGTVRLSRLIGADNAIEWIASGAEKNAAAALS
DGAVDAVIEHEQVKAEALVLLHRVASGELDYLQRRQAKQGKLQLNPIESMMVFETAKGFV
AAKAGKHYPAPVEAIKTMQKHAGFERDKALAIEAKGFAKMAKTAVAKNLIGLFLNDQKIK
KIAKQHAKAARDVKQAAVLGAGIMGGGIAYQSAYKGTSILMKDINEAGLQLGLDEATNIL
LAAVERKRLDVRGVAQTLTRIRPTLSYGDFNQVDVCVEAVVENVRVKKTVLAEAETHLRP
GAVLASNTSTISITELASVLTRPEDFCGMHFFNPVNRMPLVEVIRGEKTSEETIATVVAY
AQKMGKTPIVVNDCPGFLVNRILFPYFGGFAGLLRDGADFERVDKLMERFGWPMGPAYLM
DVVGIDTGVHAQAVMAEGFPDRMQQDYRTAMDVMFDAERYGQKNGSGFYQYALDKKGKLK
KTSDPSAHELVATVRLDQRELSDDDIIHRLMLPMCLETIRCLEDGIVASAAEADLGLIYG
VGFPPFRGGALKYVDDLGAAAFVALCDRYQELGKLYEPTQKLRDMAANNQTFYTQ
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgatctaccagggcaagaacatcaccgtgacctcgctcgccggggatttagccgagctg
gtctttgatctggccggcgagtcggtcaataaattcgatcaactgaccctggctgagctg
ggtgcagcaactgagcacatgcgtgcggcaaagctgaagggattgttggtgaccagtgca
aaacagagctttatcgtcggcgccgatattaacgaattccaacagtggtttgaacaagac
gaggcgggcattattgtcgatgtgctcaaggccaacgcgatttttagcgcctttgaggat
ttaccgtttcccaccgtcgtcgcgatcaatggcatctgcctaggcggtggcatggagatg
gccttagcctgtgattatcgtttgatgtcgacccaggccaaggtcggcctgccggaggtc
aagctcggcctgtttcccggttttggcggcacggtgcgcctgtcgcgcctgatcggcgcc
gataatgccatcgaatggatcgcctctggtgccgaaaagaatgccgccgccgccctcagc
gatggtgcagttgatgcggtcatcgagcacgagcaggttaaggccgaggccttggtgcta
ttgcatcgggtagccagtggtgaattggactacctgcagcggcgtcaagccaaacagggc
aaattacagctcaatccaattgaaagcatgatggtttttgaaaccgctaagggctttgtc
gcggccaaggccggtaagcactatccggccccagttgaggccattaaaaccatgcaaaaa
cacgccggtttcgagcgcgataaggcgttggctattgaagctaagggttttgccaagatg
gccaagacggctgtggcgaaaaacctcatcgggctgtttttaaatgatcaaaaaatcaag
aagattgctaaacagcacgcgaaagccgcgcgcgatgttaagcaggccgcggtgctaggc
gccggcattatgggcggcggtatcgcctaccagagtgcctacaagggcacgtcgatcctg
atgaaggacatcaatgaagccgggctgcaattgggcctcgatgaggccactaatatttta
ctcgccgcggtggagcgcaaacgtttggacgtgcgcggcgtggcccagacgctaacgcgc
attagaccgaccctgagttatggcgattttaaccaggtagatgtctgcgtagaggcggtc
gtggaaaacgtccgggttaaaaagacggttttggccgaggccgaaacgcatctgcggccc
ggtgccgtcttagcgtccaatacctcaaccatctcgattacagagttggctagcgtcctg
acccggccggaagacttctgcggcatgcactttttcaatccggtcaatcggatgccgctg
gtggaagtgattcggggtgaaaaaacttccgaagaaaccatcgcaaccgtggtggcctat
gcccagaaaatgggcaaaaccccgattgtcgtcaatgattgcccgggtttcttggtgaat
cgaatcctctttccctattttggtggttttgccggtctattgcgtgacggcgccgacttt
gaacgggtcgataagctgatggaacgcttcggctggcccatgggtccggcctatctaatg
gacgtggttggtatcgataccggtgtccatgcccaggcagtgatggcggagggcttcccg
gatcgcatgcagcaggattatcgcacggcgatggatgtgatgttcgatgccgaacgctat
ggtcagaaaaatggcagtgggttttatcaatacgcgctcgataaaaagggcaagctgaaa
aagacgtccgatccgagcgcgcatgagctggtcgctacggtgcgtttggaccagcgggag
ctgagcgatgatgacattatccatcggctgatgctacccatgtgtctggagaccattcgc
tgcctagaggatggcatcgtcgccagtgcggccgaggccgatctgggtctgatctatggc
gtcggtttcccgcctttccgtggcggtgccctgaagtatgtcgatgatctcggcgcggcc
gcctttgtggccctgtgtgatcgctatcaagagcttggcaagctctatgagccgacccaa
aaactgcgcgacatggcagccaataatcaaacattttacacccaatag

DBGET integrated database retrieval system