KEGG   Reinekea forsetii: REIFOR_01562Help
Entry
REIFOR_01562      CDS       T05208                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
rfo  Reinekea forsetii
Pathway
rfo00020  Citrate cycle (TCA cycle)
rfo00190  Oxidative phosphorylation
rfo00650  Butanoate metabolism
rfo01100  Metabolic pathways
rfo01110  Biosynthesis of secondary metabolites
rfo01120  Microbial metabolism in diverse environments
rfo01130  Biosynthesis of antibiotics
rfo01200  Carbon metabolism
Module
rfo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rfo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rfo_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rfo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    REIFOR_01562
   00650 Butanoate metabolism
    REIFOR_01562
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    REIFOR_01562
Enzymes [BR:rfo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     REIFOR_01562
    1.3.5.4  fumarate reductase (quinol)
     REIFOR_01562
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C DAO Thi4 Pyr_redox_2 GIDA FAD_binding_3 HI0933_like Pyr_redox_3 NAD_binding_7 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ATX76707
UniProt: A0A2K8KPK6
LinkDB All DBs
Position
1679585..1681357
Genome map
AA seq 590 aa AA seqDB search
MAKMKTMNFDAIVIGGGGAGLRAALQLAESGLNTAVVSKVFPTRSHTVSAQGGITCAIAS
DDPNDDWRWHMYDTVKGSDYIGDQDAIEYMCSVGPQAIFELDHMGLPFSRTEEGRIYQRP
FGGQSKDYGKGGQAARTCAAADRTGHALLHTLYQANIKAGTNFLNEWYAVDLVKNAEGAV
VGCIAIEIETGDVVNVSAKATVLATGGAGRIYASTTNAMINTGDGIGMALRAGFPVQDME
MWQFHPTGIYGAGTLVTEGCRGEGGYMVNGEGERFMERYAPNAKDLAGRDVVARSMVLEI
LEGRGAGPNKDHVLLKLDHLGEELLKSRLPGILELSKTFAHVDPVKEPIPVVPTCHYMMG
GIPTNIGGQAIMLDANGNDKIIDGLYACGEAACVSVHGANRLGGNSLLDLVVFGRAAGIQ
IEESIRQGYDSMAASQSDIDQALSRLSELDARKGGENVADVKRDLQNTMQLYFSVFRDGP
KMAEGRQKLVEIRERISRISLADRSLTFNTARIEVLELANLMEVAEATAISADERTESRG
AHARYDFDSRDDENWLCHSLYNPVDKTVGKRAVNFTPKTVETFQPMIRTY
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaatgaaaaccatgaatttcgatgcaatagtgataggtggtggcggtgctggt
ttgcgcgctgccctgcaattggctgagtctggtttaaatacagcagttgtctccaaagtt
ttcccgacacggtcccatactgtgtccgctcaaggtggcatcacctgcgcgatcgccagt
gacgatccgaatgatgattggcgttggcatatgtacgataccgtcaaagggtccgactat
attggtgaccaggacgctatcgaatatatgtgctcagtcggcccgcaagcgatcttcgag
ttagatcacatgggtctgcccttttcccggactgaagagggccgcatctatcagcgtccc
tttggtggtcagtcaaaagactacggcaagggcggtcaagcagctcgtacctgcgcggcg
gcggaccgaaccggtcatgccttgttacacacgctttatcaagcaaacattaaggccggc
accaacttcttgaacgagtggtacgctgttgacctggtaaagaatgccgagggtgcagtg
gttggctgtatcgcgattgaaattgaaactggcgacgtggttaatgtcagtgccaaggca
actgtcttagcgaccggcggagcagggcgtatctatgcctcgactaccaatgccatgatc
aataccggcgacggcatcggcatggccttgcgcgctggctttccagtacaagatatggaa
atgtggcaatttcacccgacgggcatctacggtgctggaacgctggttaccgaagggtgc
cgaggcgagggcggctacatggtcaatggcgaaggcgagcgctttatggagcgttacgcg
cccaatgccaaagacttggccggccgagacgttgtggcgcgctccatggtgctggaaatc
ctcgaaggtcgtggtgccggtcccaacaaggaccacgtcctgttgaaattggaccaccta
ggcgaagagttgttgaaaagtcgtttgccgggcattctcgaattgtcgaaaacctttgct
cacgtggatccagttaaagagccgatccccgtggtgccaacgtgccactatatgatgggt
ggtattccaaccaatatcggcggtcaggccattatgttagacgccaatggcaacgataag
atcatcgatggtttgtatgcgtgcggtgaagcggcctgtgtatcggtccatggtgccaac
cgactcggtggtaattcactgctcgacctggtggtatttggccgcgccgctggcatccag
attgaagaatctatccgccaaggctacgacagcatggcagccagccaaagtgatattgac
caggcattgtcccgcttgagcgaactggacgcccgtaagggtggcgagaacgttgccgat
gttaaacgagatctgcaaaacaccatgcaactgtacttcagtgtcttccgagatggtccg
aaaatggctgaaggccgtcagaagttggttgagatccgtgagcgcatcagtcggatttcc
ctggccgatcggtcattgacctttaacacggcgcgcatcgaagtactggaattggctaat
ttgatggaagtcgctgaggcaaccgctatttctgccgatgagcgtactgaaagccggggc
gcgcatgcgcgttatgactttgattcacgcgacgacgaaaactggttgtgccattcgctc
tataacccagtcgataagactgtcggcaagcgtgctgtgaacttcacaccgaagaccgtt
gaaaccttccagccgatgattcgcacctactaa

DBGET integrated database retrieval system