KEGG   Reinekea forsetii: REIFOR_01563Help
Entry
REIFOR_01563      CDS       T05208                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
rfo  Reinekea forsetii
Pathway
rfo00020  Citrate cycle (TCA cycle)
rfo00190  Oxidative phosphorylation
rfo00650  Butanoate metabolism
rfo01100  Metabolic pathways
rfo01110  Biosynthesis of secondary metabolites
rfo01120  Microbial metabolism in diverse environments
rfo01130  Biosynthesis of antibiotics
rfo01200  Carbon metabolism
Module
rfo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rfo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rfo_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rfo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    REIFOR_01563
   00650 Butanoate metabolism
    REIFOR_01563
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    REIFOR_01563
Enzymes [BR:rfo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     REIFOR_01563
    1.3.5.4  fumarate reductase (quinol)
     REIFOR_01563
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer4_7 Fer4_18 Fer4
Motif
Other DBs
NCBI-ProteinID: ATX76708
UniProt: A0A2K8KPL7
LinkDB All DBs
Position
1681370..1682077
Genome map
AA seq 235 aa AA seqDB search
MKVSIYRFNPEVDKRPYMQDYDVDVPAGKDLMVLDVLNLAKEQDVSLSFRRSCREGVCGS
DGMNINGKNGLGCITALSDVPGGSTKLVLRPLPGLPVIRDLVIDMSTFYKQYEKVQPFLI
NDTPAPALERLQSPAEREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLQAYRFLA
DSRDTATDERLANLDDPFSVFRCRGIMNCVNVCPKGLNPTRAIGHIRSMLLNRAI
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgagtatttatcgattcaatcctgaggttgataagcggccctacatgcaggac
tatgatgttgatgtcccggccggcaaagacctaatggtgctggacgtactgaatctggcc
aaagaacaggatgtgagcctgtcgtttcgccgatcttgtcgtgaaggcgtatgcggttcc
gatggtatgaatattaatggcaaaaacggtctcggctgtattaccgctttgtcggatgtg
cctggtggcagcacaaagttggtgttgcgtccgctgccgggtctgcccgtgattcgcgat
ttggtcatcgacatgagtactttttacaagcagtatgagaaagtacagccgtttttgatc
aacgataccccggcacctgccttagaacgactgcagtcgccggccgagcgtgagaagttg
gacggtctgtatgagtgtattctttgtgcttgctgctcaacatcgtgcccatcgttttgg
tggaatcctgacaagtttatcggtccggccggcttgctccaggcctatcggttcctagcc
gacagtcgggataccgcaaccgacgagcgtttggccaatttagatgatccgtttagcgtg
tttcgctgccgtggtatcatgaattgtgtgaatgtttgtccaaaaggcttgaatcctacc
cgtgctatcgggcatattcggtcaatgctgttaaatagagcaatctaa

DBGET integrated database retrieval system