KEGG   Reinekea forsetii: REIFOR_02904Help
Entry
REIFOR_02904      CDS       T05208                                 

Definition
(GenBank) anion exporter, TauE/SafE family
  KO
K07090  uncharacterized protein
Organism
rfo  Reinekea forsetii
Brite
KEGG Orthology (KO) [BR:rfo00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    REIFOR_02904
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: ATX78025
UniProt: A0A2K8KTG0
LinkDB All DBs
Position
complement(3171097..3171852)
Genome map
AA seq 251 aa AA seqDB search
MEITVITVSLLLGTGLIAGIINTLAGGGSNLTLPALMIMGLPADMANATNRVGVIMHTMV
TLRSFSRHGKLPMQGAKGLFVPVLVGGVIGSILASYLPATLLKPILLTTMISMSLVMLFR
PGMVFPSAHEQPQALVRWSKSWWLLLLSGVYGGFVQAGVGFVLIAVIAGGLRYDLVRTNA
LKILCTGTFTSVALALFIWRGQVVWVPGLILASATMAGGLIGVRLALNISPLVMKWVLFV
MTVVVSIAALL
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggaaattaccgtaataaccgtgagcctgctgttaggcactggcctgatcgctggcatt
atcaataccttggccggtggcggatccaacctgaccctacccgccctaatgatcatgggc
ctgccagcagatatggccaatgcgaccaacagggtcggggttatcatgcacaccatggtc
accctgcgcagcttttcccggcacggtaagttgccgatgcagggcgccaaggggctgttt
gtgccggtattagtgggcggggtgatcggctcaatacttgcctcttacctaccggccacc
ctgctcaagcccattttgttgaccactatgatcagtatgtcgttggtgatgctgtttcgt
cccggcatggtctttccctcagctcatgaacaaccccaggctctggtgcgctggagcaag
tcctggtggctgctgctgctgtcgggtgtctacggtggttttgtccaggccggggtcggc
tttgtcctgatcgctgtgatcgccggtgggctgcgctacgatctggtgcgcaccaatgcg
ctcaagatcctctgtaccggtacctttaccagcgtggccttggcgctctttatttggcgc
ggccaggtggtctgggtgccgggtcttatcttggcgtcggcgaccatggcgggcggtctt
atcggcgtgcgtctagccttaaacattagcccattggtgatgaaatgggtgttgtttgta
atgacggttgtagtcagtattgctgcactgctctaa

DBGET integrated database retrieval system