KEGG   Reinekea forsetii: REIFOR_03197Help
Entry
REIFOR_03197      CDS       T05208                                 

Definition
(GenBank) 33 kDa chaperonin (heat shock protein 33) (Hsp33)
  KO
K04083  molecular chaperone Hsp33
Organism
rfo  Reinekea forsetii
Brite
KEGG Orthology (KO) [BR:rfo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rfo03110]
    REIFOR_03197
Chaperones and folding catalysts [BR:rfo03110]
 Heat shock proteins
  HSP33
   REIFOR_03197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33
Motif
Other DBs
NCBI-ProteinID: ATX78303
UniProt: A0A2K8KUD0
LinkDB All DBs
Position
3499203..3500090
Genome map
AA seq 295 aa AA seqDB search
MTVLDNTTRFLFADSAVRGELTQLDRSVSEVLSKHHYPAAIQPLLGEFMAAAAMLSDTIK
FEGTLSLQVRGSGQVRSLMAECRDNRALRALAQYNDDFDDRGPILGEGQMAITIEPKQGH
RYQGVVEINDSDLGLAQVLEGYFQRSEQIRTRIWLFADQHKAGGLMLQAMPQSASESSLT
GGDDEDDDSWSRLVILASTLKPEEIFGLEAETVLHRLFHEEPVRLYPPRPLEFECTCSAD
RSGNAIITLGAPEALALIEELGHIDIDCQFCHERYIFGADDVQRLFSPSADDTLN
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgactgtactcgataacaccacgcgttttttatttgcagactccgctgtccgaggggaa
ctgactcaactggatcgttcagtctccgaggtactcagcaagcatcattatccggccgcg
attcaaccgctactcggcgaatttatggccgccgctgcgatgctcagcgataccattaaa
tttgagggcaccctgtcattgcaagtgcgcggctccggtcaggtgcgctcactgatggcc
gaatgccgagataatcgcgccttgcgggcattggcccaatataatgatgactttgatgac
cggggcccgattctcggcgagggtcagatggcgatcaccattgagccaaaacagggccat
cgctaccagggcgtggtggaaattaacgactcagacctgggtttggcccaagtgctggag
ggttattttcaacgctccgaacagatccgcacgcgcatttggttgtttgccgatcagcat
aaggccggcggccttatgctacaggcgatgccgcagtcggccagcgagagcagtttgacc
ggtggcgacgatgaggacgatgacagctggtcacgcctggttatcttggctagcacccta
aagccggaggagatctttggccttgaagccgagacggtgctgcatcgcctgtttcatgag
gagcctgtgcggctctatccgccgcggccgctagaatttgaatgcacctgcagtgccgat
cgatcgggcaatgccatcatcacattgggcgccccagaggcattggccctgattgaggaa
ctgggccatattgatatagattgtcagttttgccatgagcgctatattttcggggctgac
gacgtccaacgtttgttctcgccaagcgcagacgatacccttaattag

DBGET integrated database retrieval system