KEGG   Rhodoferax ferrireducens: Rfer_0047Help
Entry
Rfer_0047         CDS       T00334                                 

Definition
(GenBank) glutathione S-transferase-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rfr  Rhodoferax ferrireducens
Pathway
rfr00480  Glutathione metabolism
rfr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rfr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Rfer_0047
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rfr02000]
    Rfer_0047
Enzymes [BR:rfr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Rfer_0047
Transporters [BR:rfr02000]
 Other transporters
  Pores ion channels [TC:1]
   Rfer_0047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_3 GST_N GST_C_2 GST_N_3 GST_N_2 2Fe-2S_Ferredox
Motif
Other DBs
NCBI-ProteinID: ABD67809
UniProt: Q21QL7
LinkDB All DBs
Position
complement(49239..49847)
Genome map
AA seq 202 aa AA seqDB search
MKLYYSPGACSLSPHIALQEAGLAFEAIRAPTKTHQLADGTDYYTINPLGYVPLLALDDG
TQLREGPAIVQYIADQVPAKQLAPANGTFARYKLQEWLNFIGTELHKGFSPLFTPGMPEE
AKTIAKTRLNSRLQWVDGELAKTPYLMGDTFTVADGYLFVVAGWTKHVGIDISALANLGA
FMSRVGERPAVQAALRAEGLLK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctactactccccgggcgcctgctcgctatcgccccacattgcactgcaggag
gccggcctggcttttgaagccattcgcgcgccaaccaaaacccaccagctggctgacgga
accgactactacaccatcaacccactcggttacgtgccgctgctggcactcgatgacggc
acccagctgcgtgaaggccccgccatcgtgcagtacatcgccgaccaggttccggccaaa
caactggcgccagccaacggcacgtttgcgcgctacaaactgcaggaatggctcaacttc
attggcaccgaactgcacaaaggcttttcgccgctgttcacccccggcatgcccgaggag
gccaaaaccatcgccaagacccgtctgaactcgcgcctgcaatgggtcgacggcgagctg
gccaagacgccttatttgatgggtgacacgttcacggtcgccgacggctatctgttcgtg
gtggcgggctggactaaacatgtcggcatcgatatctccgccctggctaacctgggcgcc
ttcatgagccgcgttggtgaacgccccgccgtgcaggccgccctgcgtgccgaaggcttg
ctcaaatag

DBGET integrated database retrieval system