KEGG   Rhodoferax ferrireducens: Rfer_0488Help
Entry
Rfer_0488         CDS       T00334                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
rfr  Rhodoferax ferrireducens
Pathway
rfr00473  D-Alanine metabolism
rfr01100  Metabolic pathways
rfr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rfr00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Rfer_0488
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Rfer_0488
Enzymes [BR:rfr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Rfer_0488
Peptidoglycan biosynthesis and degradation proteins [BR:rfr01011]
 Precursor biosynthesis
  Racemase
   Rfer_0488
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ABD68240
UniProt: Q221R3
LinkDB All DBs
Position
504569..505693
Genome map
AA seq 374 aa AA seqDB search
MPRPIQATIHTAALRHNLARARLAAPDAKVWAIVKANAYGHGIERVFEGLRAADGFALLD
LDEAQRVRALGWRGPILLLEGVFELRDLELCSRLDLWHTVHCDEQIDMLASHKTKVAQRV
FLKMNSGMNRLGFTPQRYRAAWTRLNALPQVDEISLITHFSDADGARGITEQMAVFAEVT
RDLPGERTLSNSAATLLHTPARQPGDGFVASDWVRPGIAIYGSAPDFPQHSATDWGLQPS
MTLTAKIIATQTVDTGASVGYGSTFVADKPIQVGVVACGYADGYPRLCPTGTPVLVNGIR
TRTVGRVSMDMLAVDLSAVTAAGGQVGIGSEVTLWGRAANGLVLGIDEVAQPAGTVGYEL
MCALAPRVPVLVAD
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgccccgcccgatccaagccaccattcacaccgctgccctgcgccacaatctggcgcgc
gcccgtctggccgcgccagatgcaaaagtctgggccatcgtcaaggccaatgcctacggc
catggcattgagcgcgtgtttgaaggcctgcgcgcggccgacggctttgccctgctggac
ctggacgaagcgcagcgcgtgcgggcgctgggctggcgtggaccgatccttttgttggag
ggtgtgttcgagttgcgcgacctggagctgtgctcgcgcctggacctgtggcacaccgtg
cactgcgacgagcagatcgacatgctggccagccacaagaccaaggtggcgcaacgggtg
ttcctgaaaatgaattccggcatgaaccggctcggctttacgccgcaacgctaccgcgcc
gcctggacgcgtctgaatgccctgccgcaggttgatgaaatttccctgatcacgcatttc
agcgacgccgatggcgcgcgcggcatcaccgagcagatggcggtgtttgccgaagtcacg
cgcgacctgccgggcgagcgcaccttgagcaacagcgcggccaccctgcttcacacgccc
gccaggcagccgggcgacggcttcgtcgcctccgactgggtgcgccccggcatagccatt
tatggcagcgcgccggactttccccagcacagcgccactgactgggggctgcagcccagc
atgacacttactgcaaaaataatagctactcaaacagtggatacgggggctagcgtcgga
tatggctcaacatttgtggccgacaagccgatccaggtcggtgtcgtcgcctgcggctat
gccgacggctacccgcgcctgtgccccacgggcacgccggtgctggtgaacgggattcgc
acgcgcaccgtgggccgcgtgagcatggacatgctcgccgtcgacctgagtgccgtgacg
gcagccggtggccaggttgggatcggcagcgaggtcaccctgtgggggcgtgccgccaat
ggcctggtgctggggatcgacgaggtggcgcagccggccgggacggtgggctacgaactg
atgtgcgcactggcgccgcgagtccccgtgctggtcgcagactga

DBGET integrated database retrieval system