KEGG   Rhodoferax ferrireducens: Rfer_1798Help
Entry
Rfer_1798         CDS       T00334                                 

Definition
(GenBank) succinate dehydrogenase subunit B
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
rfr  Rhodoferax ferrireducens
Pathway
rfr00020  Citrate cycle (TCA cycle)
rfr00190  Oxidative phosphorylation
rfr00650  Butanoate metabolism
rfr01100  Metabolic pathways
rfr01110  Biosynthesis of secondary metabolites
rfr01120  Microbial metabolism in diverse environments
rfr01130  Biosynthesis of antibiotics
rfr01200  Carbon metabolism
Module
rfr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rfr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rfr_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rfer_1798
   00650 Butanoate metabolism
    Rfer_1798
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Rfer_1798
Enzymes [BR:rfr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Rfer_1798
    1.3.5.4  fumarate reductase (quinol)
     Rfer_1798
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer4_7 Fer4_9 Fer4_18 Fer4 Fer4_4 Fer4_16 Fer4_6 Fer4_21 Fer4_2
Motif
Other DBs
NCBI-ProteinID: ABD69527
UniProt: Q21XH6
LinkDB All DBs
Position
complement(1936039..1936743)
Genome map
AA seq 234 aa AA seqDB search
MAKRTIQIYRYNPDTDAKPYMQTIEVELDGSERMLLDVLTKLKATDPTISYRRSCREGIC
GSDAMNINGKNGLACLVNMLTLPDKIVLKPLPGLPVVRDLIVDMTLFFKQYHSIKPYLIN
ETRPPEKERLQSPEERDELNGLYECILCASCTTSCPVFWWNPDKFVGPAGLLQAYRFLSD
SRDEATSERLDNLEDPYRLFRCTSIMNCVDVCPKSLNPTRAIGKIKEMMVRRAL
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggctaaacgtactatacaaatttaccgctataaccctgacaccgatgccaagccctat
atgcagaccatcgaggtcgagcttgatggcagcgaacgcatgttgcttgacgttttgact
aaactcaaagcaacggaccccaccatttcttaccggcgttcatgccgcgaaggcatttgc
ggctcggacgcgatgaacatcaacggcaagaacggtttggcttgcctggtcaatatgttg
actttgcccgacaaaattgttcttaagccgttaccaggcctgcccgtggtgcgtgacctg
attgtcgacatgacgctgttcttcaagcagtaccactcgatcaagccctatttgatcaat
gagacccggccgccagaaaaagagcgtctgcaaagtcccgaggagcgagatgaactcaat
ggcttgtatgagtgcattttgtgcgcaagctgtaccaccagttgcccagttttctggtgg
aacccggacaaatttgtcggcccggccggtttgctgcaagcctaccgattcctctcggac
agtcgcgatgaggccacgagtgagcggctcgataacctcgaagacccctatcgcctgttc
cgctgcaccagcatcatgaactgcgtcgatgtttgcccgaagagccttaatccgaccagg
gcaattggcaagatcaaggaaatgatggttcgtcgcgcgctttga

DBGET integrated database retrieval system