KEGG   Rhodoferax ferrireducens: Rfer_1799Help
Entry
Rfer_1799         CDS       T00334                                 

Definition
(GenBank) succinate dehydrogenase subunit A
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
rfr  Rhodoferax ferrireducens
Pathway
rfr00020  Citrate cycle (TCA cycle)
rfr00190  Oxidative phosphorylation
rfr00650  Butanoate metabolism
rfr01100  Metabolic pathways
rfr01110  Biosynthesis of secondary metabolites
rfr01120  Microbial metabolism in diverse environments
rfr01130  Biosynthesis of antibiotics
rfr01200  Carbon metabolism
Module
rfr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rfr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rfr_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rfer_1799
   00650 Butanoate metabolism
    Rfer_1799
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Rfer_1799
Enzymes [BR:rfr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Rfer_1799
    1.3.5.4  fumarate reductase (quinol)
     Rfer_1799
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 DAO FAD_binding_3 GIDA HI0933_like Lycopene_cycl Pyr_redox_3 NAD_binding_8 GMC_oxred_N FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: ABD69528
UniProt: Q21XH5
LinkDB All DBs
Position
complement(1936798..1938603)
Genome map
AA seq 601 aa AA seqDB search
MTATSKITKRKFDVVIVGAGGAGMSASLQLANAGLNVAVLSKVFPTRSHTVAAQGGIGAA
LGNMAEDNWHYHFYDTIKGSDWLGDQDAIEFMCREAPKVVYELEHFGMPFDRNPDGTIYQ
RPFGGHSSNYGEKPVGRACAAADRTGHAMLHTLYQQNVKARTNFFVEWMALDLIRDADGD
VVGVTALEMETGEVYILQAKTVMIASGGAGRIFAASTNAYINTGDGLGMAARAGIPLQDM
EFWQFHPTGVAGAGVLLTEGCRGEGAILRNSNGERFMERYAPTMKDLAPRDFVSRCMDQE
IKEGRGCGPNKNYINLDMTHLGAETIALRLPSVFEIGHNFANVDITKEPIPVIPTNHYQM
GGIPSNISGQVVVPSSSGAQVVVNGLYAVGECACVSVHGANRLGTNSLLDIVVFGRAAGL
HIIDFNNKNTEHKPIPANAADISIERLDRLNTATTGEYAQVVAGDMRDIMQQHASVFRTQ
ASMDEGVVKIAQLRQRVTDIKLTDKSQIFNTERIEALEVENMIEVAQSTMVSAAARHECR
GAHSVMDYDRPADDATCPLGRDDVNWLKHTLWDKATNSLSYKPVNLKPLTVASVPPKIRT
F
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgactgctacttccaaaattaccaagcgcaaatttgacgtcgttatcgtcggtgctggc
ggcgctggcatgagcgcctcgcttcaactggccaatgccggcctgaacgtcgcggtgctg
tccaaggtattcccgacacgatctcacaccgttgcagcacagggcggcatcggcgccgcc
ctaggcaacatggccgaggataactggcattatcacttttacgacaccatcaaggggtcg
gactggttgggcgaccaagatgcgattgagttcatgtgccgcgaggcgcccaaagtggtt
tacgaactcgaacacttcggcatgccgtttgaccgcaatcctgatggcaccatttaccag
cgtccttttggggggcattccagcaactatggcgaaaaaccagttgggcgcgcctgcgca
gcggcggaccgcacaggtcatgccatgctgcacacgctgtatcagcaaaacgtcaaggcg
cgaaccaatttctttgtcgagtggatggcgctggatctgattcgcgacgccgatggcgat
gtcgttggcgtcacggcactcgagatggaaaccggtgaagtctacattttgcaggcgaag
acggtcatgatagcgtcaggtggcgccggtcggatttttgccgcatcgaccaacgcctac
atcaatacgggtgatgggctggggatggcggctcgcgccggcattcctttgcaagacatg
gagttctggcagtttcaccccacgggcgtggctggcgcaggcgtcctgctcaccgaaggc
tgtcgtggtgaaggcgcgattctgcgcaacagcaatggagagcgcttcatggagcgttat
gcacccaccatgaaggacttggcgccccgcgactttgtgtcgcgctgcatggaccaggaa
atcaaggaaggacgcggttgcggcccgaacaagaactacatcaacctggacatgacgcac
ctgggtgccgagacgatcgcgctgcgcttgcccagcgtgtttgaaatcggccacaacttt
gccaatgtcgacatcaccaaagagccgatcccggtgattccgaccaaccattaccagatg
ggcggcattcccagcaatatcagcggtcaggtcgttgtgcccagcagcagtggggcgcag
gtagtcgtcaacggtctgtacgctgtgggcgaatgtgcctgtgtcagcgtgcacggcgca
aatcgactaggcaccaactccttgcttgacatcgtggtttttggccgtgctgcaggcctg
cacatcatcgatttcaacaacaagaacacggaacacaagccgataccggccaatgccgcg
gatatttccatcgaacgccttgaccggctcaacacggccacgacaggagaatacgcgcag
gttgtcgctggcgacatgcgcgacatcatgcagcagcacgccagcgtgttccgtacccag
gcgagcatggacgaaggcgtcgtcaagattgcccaattgcgccaacgcgtcaccgatatc
aagctgaccgacaagtcgcaaatcttcaacactgagcgcatcgaggcactcgaagtggaa
aacatgattgaagtggctcagtcaaccatggtgtcggcagcggcacggcatgaatgccgt
ggtgctcacagcgtgatggattacgaccgtcccgctgacgacgccacctgtccattggga
cgagacgatgtcaattggctcaaacacacattgtgggacaaagccaccaacagtctgagc
tacaagccagtcaacctcaaacccctgactgttgcctccgtaccgcccaagatccgaacc
ttttga

DBGET integrated database retrieval system