KEGG   Rhodoferax ferrireducens: Rfer_2850Help
Entry
Rfer_2850         CDS       T00334                                 

Definition
(GenBank) phenylacetaldehyde:ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
rfr  Rhodoferax ferrireducens
Pathway
rfr00030  Pentose phosphate pathway
rfr01100  Metabolic pathways
rfr01120  Microbial metabolism in diverse environments
rfr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Rfer_2850
Enzymes [BR:rfr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Rfer_2850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: ABD70561
UniProt: Q21UJ2
LinkDB All DBs
Position
complement(3147174..3149027)
Genome map
AA seq 617 aa AA seqDB search
MSWAGKILRVNLTAGTVKSEPLNMEWAQAYIGSRGLGTKYLVEEVDATVDPLSADNKIIW
ATGPLTGTMASTGGRYTVITKGPLTGAIACSNSGGYWGAEFKMAGWDMVIFEGKSAKPVF
LYVNDDLAELRDASHLWGKSVWETEEIIKKGLQDPLTRVSSIGKAGENGVLFAAVVNDLH
RAAGRSGVGAVMGSKNLKAIAVRGTKGVGNIRDPKAFMAATKAAKKILAENGVTGTGLPA
MGTQVLMSVINEIGALPTRNHQEVQFEGAKDIGAEAMATPRKTDGKKQLVTNQACFGCTI
ACGRISKMDEGHFTIENKPQYRGANGGLEYEAAWALGAANGVNDLEALQYVNLLCNEEGI
DPITFGATIGAVMELYGMGILTKEQLGIEAPFGSARAVAFLAEETVNGRGFGKEIAMGSK
RLTAKYGHPELSMSSKGQEFPAYDSRAIQGIGLAYATSNRGGCHLRGYTIASEVLGIPVK
TDPLESKGKPELVKAFQDATAAFDSAGVCIFTTFAWGLQDLSPQMQGACGEQYTIEELAK
IGERIWNMEREFNNRAGFTKADDSLPPRLTSVEGACKTGPAKGKFNELATMLPLYYEARG
WDTEGRPTAATRERLSL
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgtcatgggctggaaaaatcctccgcgttaacttgaccgcgggcaccgtcaagtctgaa
cccctcaacatggaatgggcacaggcctacatcggttcacgcggcctgggcaccaagtac
ctggtcgaggaagtggatgccacggttgacccactttctgccgacaacaagatcatctgg
gccaccggcccgctgaccggcaccatggcctccaccggaggccgctacacggtgatcacc
aaaggtccgctgactggcgccattgcctgctccaactcgggcggctactggggtgccgaa
ttcaagatggctggctgggacatggtcatttttgaaggcaagagcgccaaacccgtcttt
ttgtacgtcaatgacgacctggccgagctgcgtgatgcctcccacctgtggggcaagagc
gtctgggaaactgaagaaatcatcaagaagggcctgcaagacccgctgactcgcgtgtcc
tccattggcaaggccggagaaaacggcgtgctgtttgccgccgtggtcaacgacttgcac
cgtgctgccggtcgctccggcgtcggcgcggtcatgggcagcaaaaacctcaaggcgatt
gccgtgcgcggtaccaaaggcgtgggcaacatccgtgacccgaaagctttcatggcagcg
accaaagccgccaaaaaaatcctggccgaaaacggcgtcaccggcaccggcctgcccgcc
atgggcacccaggtgctgatgagtgtgatcaacgaaattggtgctttgcctacccgcaat
caccaggaagtgcagttcgaaggtgccaaggacattggtgcggaggccatggcaacaccg
cgcaaaacggatggcaaaaagcagttggtgaccaaccaggcctgttttggctgcaccatt
gcctgcgggcgcatcagcaagatggatgaaggccacttcaccatcgagaacaagcctcaa
taccgcggtgccaacggtggtctggaatacgaggccgcctgggcgctgggtgctgccaat
ggtgtgaatgacctggaagctctgcaatacgtcaacttgctgtgcaacgaagaaggcatt
gaccccatcacctttggcgcaacgattggtgcggtgatggagctctacggcatggggata
ctcaccaaagaacagctcggcattgaagcaccctttggctccgcccgtgcggtggccttc
ctggccgaagaaacggtcaacggccgtggttttggcaaggaaattgccatgggttccaaa
cgcctgacggccaagtatggtcacccggaactcagcatgagcagcaagggtcaggagttc
ccggcctatgacagccgtgccatccagggtattggcctggcgtatgccaccagcaaccgc
ggtggctgccacttgcgcggctacaccatcgcatcagaagttctggggatcccggtcaag
accgatccgctcgaatccaaaggcaagcccgagctggtcaaggccttccaggatgccacc
gctgcgtttgactcggctggcgtgtgcatcttcaccacctttgcctggggcctgcaagac
ctgtcaccgcaaatgcagggtgcctgcggtgagcagtacaccattgaagagctggcaaaa
attggtgaacgcatctggaacatggagcgcgagttcaacaaccgtgccggcttcaccaaa
gccgacgacagcctgccaccgcgtttgaccagcgttgagggtgcctgcaagaccggtccg
gcgaaaggcaagttcaatgagttggccaccatgctgccgctttactatgaagcgcgtggc
tgggatactgaggggcgcccaacggccgccacacgggaacgcctgagcttgtaa

DBGET integrated database retrieval system