KEGG   Rhodoferax ferrireducens: Rfer_3670Help
Entry
Rfer_3670         CDS       T00334                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
rfr  Rhodoferax ferrireducens
Pathway
rfr00564  Glycerophospholipid metabolism
rfr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rfr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Rfer_3670
Enzymes [BR:rfr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Rfer_3670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 NAD_binding_8 Pyr_redox_2 HI0933_like Thi4 Pyr_redox_3 3HCDH_N Lycopene_cycl Pyr_redox GIDA
Motif
Other DBs
NCBI-ProteinID: ABD71370
UniProt: Q21S83
LinkDB All DBs
Position
complement(4089023..4090723)
Genome map
AA seq 566 aa AA seqDB search
MVTPTQPLFTQRAELISRLAAPRHYDIAIVGGGATGLGVALDAAARGFSVVLIESHDFAK
GTSSRATKLVHGGVRYLAQGNIGLVREALRERTTLLHNAPYLAQPLAFVMPSYKWWEMPF
YGIGLTLYDALAGKAGLGRTEFLSRAKTLALLPAAQPQGLKGGVKYWDGQFNDARLALAL
GRTAAARGALLVNYCRALDLFYQEGKVAGLVCEDTLTGQTYRIQSRCVVNAAGVWVDELR
QKDGAANGADGRRPTEPMVAPSQGVHMVVDRDFLGGDTALMVPKTADGRVLFAVPWLGKV
ILGTTDTPRHDLAREPLAFKEEVDFILTESARYLRRAPKRADVKSIWVGLRPLVKPPDDE
GDNTKGLSREHTVLVSRSGLVTVTGGKWTTYRAMAEDVLAQCAAKSLIDARAAGVTVDLK
LVGADETPGQAHSISQPPGLHSYGNEQALVMSLPGAQSVLCDGLTEAMVRFAARYEYAIT
VEDVLARRSRLLFLDARLASSLAAQVGGILLQETGLDPQVDVFTELAQHYLCLPASCEQV
DQPRSLSANATEAQVLADPRQTSQRA
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atggtcaccccaacgcagccattattcacacagcgggccgaattgatcagccgtctggcc
gcgccgcgccactatgacatcgccatcgtgggcggcggcgcgacgggcctgggcgtggcg
ctggacgcagcggcgcgcggctttagcgtggtgctgatcgagtcgcacgactttgccaag
ggcacctcctcgcgcgccaccaagctggtgcatggcggcgtgcgctacctggcgcagggc
aatattgggctggtgcgcgaagcgttgcgcgagcgcaccacactgctgcacaacgcgcct
tatctggcacagccgctggcgtttgtgatgccgtcctacaagtggtgggagatgcctttt
tatggcattgggctcaccctgtatgacgccttggcgggcaaagccggcctgggacgtacc
gaatttttaagccgcgccaagacactggcgctgttgcccgcggcgcagccacaggggctc
aagggcggcgtcaagtactgggacggccagttcaacgacgcacgcctggcactggcgctg
ggccgcacggcggcggcgcgtggtgcgctgctggtgaactactgccgcgcgcttgatttg
ttttaccaggagggcaaagtcgccggactggtctgtgaagacaccctcaccggccagacc
taccgcatccagtcgcgctgcgtcgtcaacgccgccggggtctgggtcgatgagctgcgc
cagaaagacggcgccgccaatggtgccgatggccggcggcccaccgaaccgatggtggca
cccagtcagggcgtgcacatggtggtggatcgtgactttttgggtggtgataccgccttg
atggtgcccaaaactgccgatggccgtgtcttgtttgccgtgccctggctgggcaaggtg
attctcggcaccaccgacacgccacgccatgacctggcgcgtgagccgctggcgttcaag
gaagaagttgattttattctgaccgaatcggcgcgttatctgcgtcgtgcgcccaaacgc
gcggatgtcaagagtatctgggtcggcttgcgcccgctggtcaagccgccagacgacgag
ggcgacaacaccaagggcttgagccgcgagcacacggtgctggtcagccgcagtgggctg
gtcacggtgaccggcggcaagtggaccacctaccgcgccatggccgaagacgtgctggcg
cagtgcgccgccaagtctctgatcgacgcgcgtgcggccggcgtcaccgtcgatttgaaa
ctggtcggcgccgatgagacgccgggccaggcacactccatcagtcagccgcctggcctg
cattcgtatggcaacgaacaggccctggtgatgagcctgcccggcgcgcaatccgtgttg
tgcgacggcttgaccgaagccatggtgcgcttcgcggcgcgctacgagtatgcgatcacc
gtcgaagacgtcctggcgcgtcgttcccgcttgctgtttctcgatgcccgcttggccagc
tccctggcggcgcaggtgggaggcattctgttgcaggagaccgggctcgacccgcaggtt
gatgtgttcaccgagctggcgcagcactatttgtgtttgccggcatcgtgcgaacaggtc
gatcagccacgctctttgagtgccaatgcgacagaagcgcaagtccttgctgatccgcgt
caaacgtcgcagcgggcatag

DBGET integrated database retrieval system