KEGG   Rathayibacter festucae: C1I64_16195Help
Entry
C1I64_16195       CDS       T06173                                 

Gene name
pknB
Definition
(GenBank) Stk1 family PASTA domain-containing Ser/Thr kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
rfs  Rathayibacter festucae
Brite
KEGG Orthology (KO) [BR:rfs00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rfs01001]
    C1I64_16195 (pknB)
Enzymes [BR:rfs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     C1I64_16195 (pknB)
Protein kinases [BR:rfs01001]
 Serine/threonine kinases: Other
  Bacterial family
   C1I64_16195 (pknB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Pkinase_fungal Kinase-like Kdo Seadorna_VP7
Motif
Other DBs
NCBI-ProteinID: AZZ53424
UniProt: A0A3Q9V0G9
LinkDB All DBs
Position
3542557..3544260
Genome map
AA seq 567 aa AA seqDB search
MTDEGRLIAGRYQVGPRLGRGGMSEVYLGTDTRLGRTVAIKELKLSLSSDSAFRLRFRQE
AQSASRMSHPTIVRVFDAGEEVSLDDTGAESRRPFIVMEHIEGRLLKDVIAEGPVEVDEA
VRITEGILTALEYSHRAGVVHRDIKPGNIMLTPSGQVKVMDFGIARAVSDSAATVAQTTA
ILGTAAYFSPEQAKGEQVDARSDLYSAGIVLFELLTGRAPFRGDTPVAVAYQHVSETPPA
PSSINPAVSPALDGVVARALSKDRYERFQGAAEFRDDLRDAAAGRLPDHRPIDELTTSLF
AARSGGGMNDSELALRQLAEDNSIVRTQRRPPVLWIWSSIVVLAVIVAALVLWVLTLQPT
TTLPSQSREVPVLTGTSYDSAQSTLTELDLVASQLAEFSDTVPAGEVIRTDPGSGTIVAP
ETVIRVYVSQGAQPVAVPETAGSTLEEAIAALTGAGFSEGSQTRQNSPTVPGDVVLSSTP
AGGQQLAPGTPVDLVVSSGQVTLPDLVGQTLSTALATLASEQLQLIGEEAPDDTCESVRA
NPPITTQSIAPGDVPQGSTVELGFCAG
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
gtgacggatgagggacgcctgatcgcaggacggtaccaggtcgggccccggctcggtcgc
ggtgggatgtccgaggtctacctcggcaccgacacccgcctggggcgcacggtcgcgatc
aaggagctcaagctctcgctgtcctccgactccgcgttccgcctgcgcttcaggcaggag
gcgcagtccgcgtcccgcatgtcgcacccgaccatcgtccgcgtcttcgacgccggcgag
gaggtctcgctcgacgacaccggcgcggagtcgcgccgtccgttcatcgtgatggagcac
atcgaggggcgcctgctgaaggacgtcatcgcggagggaccggtcgaggtcgacgaggcc
gtccgcatcaccgagggcatcctcaccgcgctcgagtactcccaccgcgcgggggtcgtc
caccgcgacatcaagccgggcaacatcatgctgaccccctcaggccaggtgaaggtgatg
gacttcgggatcgcccgcgccgtctccgactccgccgcgaccgtggcgcagaccaccgcc
atcctcggcaccgccgcctacttctcgccggagcaggcgaagggcgagcaggtcgacgcc
cgcagcgacctctactccgccggcatcgtcctcttcgagctgctcaccggccgcgctccc
ttccgcggggacaccccggtggccgtcgcctaccagcacgtcagcgagacgcccccggcg
cccagctcgatcaacccggccgtctcgcccgccctcgacggcgtcgtcgcccgagcgctg
tcgaaggaccgctacgagcgcttccagggagcggccgagttccgcgacgacctgcgcgac
gccgcggccggccgcctccccgaccaccgcccgatcgacgagctgaccacgtctctcttc
gccgcacgcagcggcggcggcatgaacgactccgagctcgcgctgcgccagctcgcggag
gacaactcgatcgtccgcacccagcgccgcccgccggtgctctggatctggtcgtcgatc
gtcgtgctcgccgtcatcgtggcggcgctggtgctctgggtgctcacgctccagccgacg
accacactgccctcgcagtcgcgcgaggtccccgtgctgacgggcaccagctacgacagc
gcgcagtcgactctcaccgagctcgacctggtggcgagtcagctcgccgagttcagcgac
acggtcccggccggcgaggtgatccgcaccgatcccggctccggcacgatcgtcgcgccc
gagacggtcatccgggtctacgtctctcagggcgcccagccggtggccgtcccggagacg
gcggggtcgaccctcgaggaggcgatcgccgccctcaccggggccggcttctcggaggga
tcgcagacccgccagaactcgcccaccgtgccgggtgacgtggtgctctccagcactcct
gccggcggccagcagctcgccccggggacgccggtcgacctcgtcgtctcctcgggccag
gtgaccttgcccgacctcgtcggccagacgctgagcaccgccctcgccaccctggcgtcc
gagcagctccagctgatcggcgaggaggctcccgacgatacctgcgagtccgtccgggcc
aaccccccgatcaccacccagtcgatcgccccgggcgacgtcccccagggctccaccgtc
gagctcggcttctgcgccggctga

DBGET integrated database retrieval system