KEGG   Rhizobium gallicum: RGR602_CH00101Help
Entry
RGR602_CH00101    CDS       T03539                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
rga  Rhizobium gallicum
Pathway
rga00250  Alanine, aspartate and glutamate metabolism
rga00410  beta-Alanine metabolism
rga00640  Propanoate metabolism
rga00650  Butanoate metabolism
rga01100  Metabolic pathways
rga01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rga00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RGR602_CH00101 (gabT)
   00650 Butanoate metabolism
    RGR602_CH00101 (gabT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RGR602_CH00101 (gabT)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RGR602_CH00101 (gabT)
Enzymes [BR:rga01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     RGR602_CH00101 (gabT)
Amino acid related enzymes [BR:rga01007]
 Aminotransferase (transaminase)
  Class III
   RGR602_CH00101 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: AJD39477
UniProt: A0A0B4WZ07
LinkDB All DBs
Position
complement(113066..114346)
Genome map
AA seq 426 aa AA seqDB search
MNTITLTDRKNAAISRGVGMTTQIYADRAENAEIWDKEGRRYIDFAAGIAVLNTGHRHPR
VIAAVKDQLDHFTHTCHQVVPYESYVHLAERLNALTPGNFAKKTIFVTTGAEAVENAVKI
ARAATGRSAVIAFGGGFHGRTFMGMALTGKVVPYKVGFGAMPGDVFHVPFPVEMHGVSLE
QSLCALKKLFAADVDPQRVAAIIIEPVQGEGGFYPAPVAFMKALRELCDQHGILLIADEV
QTGFARTGKMFAMDHHEVAPDLMTMAKSLAGGFPLAAVTGRAEVMDAPAPGGLGGTYGGN
PLGIAAAHAVLDVIKDEDLCNRANQLGGHLKQRLEALRDKVPEIADIRGPGFMNAVEFND
KATKLPSADFANRIRLIALDKGLILLTCGVHGNVIRFLAPITIQDNIFVEALDILEASIL
QASAGK
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgatcacccttacggaccggaagaatgccgccatttcgcgcggcgttggcatg
accacgcagatctatgccgaccgagcggagaatgccgagatctgggacaaggagggacgc
cgctacatcgatttcgcggccggtatcgcagtgctcaacacgggccatcgccatccgcga
gtgatcgccgcggtaaaagatcaactcgatcacttcacccatacctgccatcaagtcgtg
ccttatgaaagctacgtgcatctcgccgaacgtctgaacgcgctgacgcccggaaacttt
gccaagaagacgatcttcgtgacgacgggcgccgaggccgtcgaaaacgccgtgaaaata
gcgcgtgctgcgaccggccgctccgccgtcatcgcctttggcggcggcttccatggccgc
accttcatgggcatggcgctgaccggcaaggtcgtgccctacaaggttggcttcggcgcg
atgccgggcgatgttttccacgtgccgttccccgtcgagatgcatggggtgtctcttgaa
cagtcgctttgcgccctgaagaagctctttgccgccgatgtcgatccgcagcgcgtcgcc
gctatcatcatcgaaccggttcagggcgaaggcggtttctatccggcgccggtcgcattc
atgaaggcgctacgcgaactctgcgaccagcacggcattctactgatagccgacgaagtg
cagacgggctttgcacgcacgggtaagatgtttgcgatggaccaccatgaggtcgcgccc
gacctgatgaccatggcaaagagccttgccggcggctttccgctggctgccgtcaccggt
cgcgcggaggtcatggatgcacctgcccctggcggtctcggcggcacctatggcggcaac
cccctcggcatcgcagcggcacatgccgtgctcgacgtcatcaaggatgaggatctctgc
aaccgagccaaccagctcggcggccacctgaagcaacggttggaagctctgcgcgacaag
gtgccggaaatcgccgacatccgcggcccgggcttcatgaacgccgtcgagttcaacgac
aaggcgacaaagctgccgagcgcggatttcgcaaataggatccgcctgatcgcgctggat
aagggtctcattcttttgacctgcggcgtgcacggaaacgtcattcgcttccttgccccg
atcaccatccaggacaatatcttcgtcgaagcgctcgacatcctcgaagcctctatcctt
caagcaagtgcgggcaagtaa

DBGET integrated database retrieval system