KEGG   Rhizobium gallicum: RGR602_CH00149Help
Entry
RGR602_CH00149    CDS       T03539                                 

Gene name
fabI-1
Definition
(GenBank) NADH-enoyl acyl carrier protein reductase 1
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
rga  Rhizobium gallicum
Pathway
rga00061  Fatty acid biosynthesis
rga00780  Biotin metabolism
rga01100  Metabolic pathways
rga01130  Biosynthesis of antibiotics
rga01212  Fatty acid metabolism
Module
rga_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:rga00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    RGR602_CH00149 (fabI-1)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    RGR602_CH00149 (fabI-1)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    RGR602_CH00149 (fabI-1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rga01004]
    RGR602_CH00149 (fabI-1)
Enzymes [BR:rga01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     RGR602_CH00149 (fabI-1)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     RGR602_CH00149 (fabI-1)
Lipid biosynthesis proteins [BR:rga01004]
 Fatty acid synthase
  Component type
   RGR602_CH00149 (fabI-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AJD39523
UniProt: A0A0B4WYX9
LinkDB All DBs
Position
complement(155240..156046)
Genome map
AA seq 268 aa AA seqDB search
MTAIMQGKRGLIMGVANNHSIAWGISRALAAQGAELAFTYQGEALGKRVKPLAAEVGSDF
VVPCDVEDIASVDGVVGALEERWGKLDFIVHAIGFSDKNELKGLYADTTRENFSRTMVIS
CFSFTEIARRCAPLMAEGGSMLTLTYNGSTRVIPNYNVMGVAKAALEASVRYLAADYGPR
GIRVNAISAGPIRTLAGAGISDARAILSWNQRNAPLRKTVSIDQVGNSALYLLSDLSAGV
TGEIHFVDAGYNITSMPTLDTLRKADVE
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcaatcatgcagggtaagcgcgggctcatcatgggcgtcgccaacaaccattct
atcgcctggggtatatcaagggcgcttgcagcccaaggcgccgagcttgcctttacctat
cagggagaggcgctcggcaagcgggtgaaaccgctcgcagcggaagtcggctcggatttc
gtcgtaccctgcgacgtcgaagacattgcctcagtcgacggcgttgttggtgcactcgag
gagcgttggggcaaactggatttcatcgtccatgccatcggtttttccgacaagaacgag
ctgaagggcctctacgcggatactacgcgcgaaaacttcagccgaacgatggtcatctcc
tgcttttcctttacggagatcgccaggcgctgcgcaccgctgatggccgagggcggttct
atgctgacgctgacatataacggttccacacgcgtcatcccgaactacaacgtcatgggg
gttgcaaaggctgctctggaggcctccgtgcgctatctcgccgccgactacggtccgcgc
ggcatccgcgttaacgccatctccgcgggccccatccgcacgctggcgggcgcgggcatt
tcggatgcccgtgcaatcctctcctggaaccagcggaatgctcccctgcgcaagaccgtc
agtatcgatcaggtcggcaattccgccctctacctgctctccgacctgtccgcaggcgtg
accggcgaaatccattttgtggacgccggctacaacataacctcgatgccgacgctggat
acgctgcgcaaggcagatgtagaataa

DBGET integrated database retrieval system