KEGG   Rhizobium gallicum: RGR602_CH00419Help
Entry
RGR602_CH00419    CDS       T03539                                 

Gene name
tme
Definition
(GenBank) NADP-dependent malic enzyme
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
rga  Rhizobium gallicum
Pathway
rga00620  Pyruvate metabolism
rga01100  Metabolic pathways
rga01120  Microbial metabolism in diverse environments
rga01200  Carbon metabolism
Module
rga_M00169  CAM (Crassulacean acid metabolism), light
Brite
KEGG Orthology (KO) [BR:rga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RGR602_CH00419 (tme)
Enzymes [BR:rga01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     RGR602_CH00419 (tme)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB malic Malic_M ELFV_dehydrog
Motif
Other DBs
NCBI-ProteinID: AJD39790
UniProt: A0A0B4WYZ5
LinkDB All DBs
Position
411436..413718
Genome map
AA seq 760 aa AA seqDB search
MPDIEKKPQPVTSVTDNEALEFHAMGRPGKLEINPTKPMATQRDLSLAYSPGVAVPVKAI
AADPGTAYDYTTRGNMVAVISNGTAILGLGNLGALASKPVMEGKSVLFKRFADVDSIDLE
VDTENVDEFINCVRFLGPSFGGINLEDIKAPDCFIIEQRLRELMDIPVFHDDQHGTAIIA
TAGLINALELTGRDLKTTKLVCNGAGAAAIACVELIKSMGFTPENITLVDTKGVIYQGRT
EGMNQWKSAHAVKTKARTLADAMKGADVVFGLSQKGAFSEEMIRSMADRPIIFAMANPDP
EITPEEVARIRDDAIMATGRSDYPNQVNNVLGFPYIFRGALDVRATTINDAMKIAAVKAL
ANLAREDVPDDVVAAYQGNRPRFGAQYIIPVPFDPRLISAIPAAVAQAAIETGVARKVIT
DMDGYRRELSARRDPIASTLASLYERVRRRPKRMVFAEAEEEQVMRAAMSYANQQLGTAI
LLGREDLIRATAERAGIDLNRPGLEIVNARISTRIEAYTDYLYARLQRKGYLHRDAQRLI
HNDRNHFAATMVALGDADGMVTGITRNYSTALEDVRRCIDEKPGHRVIGVSLVIVRGRAV
FVADTAVHDMPTAEELADIAEEAAGLARRMGYQPRVALLAYSTFGHPSGERSERVREAVK
ILDKRRVDFEYDGEMAADVALNRKVMEQYPFCRLSAPANVLVMPAFHSASISTKMLQELG
GSTVIGPILVGLDKAVQITSMGAKDSDIVNMAAIAAYSAG
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atgcccgatatcgaaaagaagccgcagccggtgacgtccgttaccgacaatgaagcgctc
gagtttcatgccatggggcggcccgggaagctggaaatcaacccgacgaaaccgatggcg
acgcagcgtgatctgtcgctggcctattcgccgggcgtcgcggtgccggtaaaggccatc
gccgccgatccgggcactgcctacgactacacaacgcgcggcaatatggtggctgtcatc
tccaacggcacagcaattttgggcctcggcaacctcggcgccttggcatccaagccggtg
atggaaggcaaatccgtcctcttcaagcgctttgccgatgtcgattccatcgaccttgag
gtcgacacggaaaacgtcgacgagttcatcaactgtgtgcgtttccttggcccgtctttc
ggcggcatcaatctggaggacatcaaagcgccagactgcttcatcatcgagcagcgtctg
cgcgagctgatggatattccggtctttcacgacgaccagcacggcacggcgatcattgca
acggccggcctcatcaatgccttggagctgacgggacgtgacctgaagacgacgaaactc
gtctgcaacggcgcaggagctgccgccatcgcctgtgtcgagctcatcaagtcgatgggt
tttacgcctgaaaacatcacccttgtcgacaccaagggcgtaatctatcagggccgcacc
gagggcatgaaccagtggaaatcggcacacgcggtaaagacaaaggcccgcacgctggcc
gatgcgatgaagggtgccgacgtcgtgttcggtctgtcgcagaagggtgccttttcggaa
gagatgattcgttcgatggccgaccggccgatcatctttgcgatggcaaaccccgatccg
gaaatcacgccggaggaagtcgcgcgcatccgcgatgatgccattatggcgacagggcga
tcggactacccgaatcaggtgaataacgttctcggctttccctatatcttccgcggcgcg
ctcgacgtgcgggcaaccacgatcaacgacgcgatgaagattgccgccgtcaaggcgctt
gccaatctggcccgcgaggatgtacccgatgacgtcgttgccgcttatcagggcaaccgc
ccccgctttggcgcgcaatatatcattcctgtgcccttcgatccgcgcctcatttcggca
atcccggctgccgtggcgcaggctgcgatcgaaactggcgttgcccgcaaggtgatcacc
gacatggacggctatcgccgcgagctatcggcaaggcgtgatccgatcgcttcgacgctt
gcgagcctctacgagcgggttcggcgccgtccgaaacggatggtttttgccgaggcggaa
gaagagcaggtcatgcgcgcggcgatgtcttatgccaaccagcagctcggcacggcaatc
cttcttggccgcgaagatctgatcagggcgacggcggagcgggccgggatcgacctcaac
cggccgggcctcgagatcgtcaatgcacgcatctcgacccgcattgaggcttacaccgac
tacctctatgcccggctgcagcggaaaggctatctgcaccgcgatgcacagcgcctgatc
cacaacgatcgtaatcatttcgccgcgacgatggtggcgcttggcgatgcagatggcatg
gtgaccggcatcacgcgcaattattcgacggcgctggaggacgtgcggcgctgcatcgac
gagaagccgggccaccgtgtcatcggcgtgtcgctggtgattgtccgcggccgcgcggtc
tttgtcgcagataccgcggttcacgatatgcctactgccgaggagctggccgatatcgcc
gaagaagcggcaggccttgcgcgccgcatgggctatcagccgcgcgttgccctgctcgcc
tattccaccttcggtcatccttcgggcgaacgttccgagcgcgtgcgcgaagccgtgaag
atccttgacaagcgccgcgtcgatttcgagtatgatggcgaaatggcagccgacgtggcg
ctgaaccgaaaggtgatggagcagtacccgttctgccgcttgtcggctcccgccaacgtg
ctggtcatgccggccttccactccgcttcgatctcgacgaagatgctgcaggaactcggt
ggctcgacggtcatcggcccgatccttgtcggcctcgacaaagccgttcagatcacctcg
atgggcgccaaggactccgacatcgtcaacatggcggcgatcgcggcttattcggcgggc
tag

DBGET integrated database retrieval system