KEGG   Rhizobium gallicum: RGR602_CH00637Help
Entry
RGR602_CH00637    CDS       T03539                                 

Gene name
dadX
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
rga  Rhizobium gallicum
Pathway
rga00473  D-Alanine metabolism
rga01100  Metabolic pathways
rga01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rga00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    RGR602_CH00637 (dadX)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    RGR602_CH00637 (dadX)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rga01011]
    RGR602_CH00637 (dadX)
Enzymes [BR:rga01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     RGR602_CH00637 (dadX)
Peptidoglycan biosynthesis and degradation proteins [BR:rga01011]
 Precursor biosynthesis
  Racemase
   RGR602_CH00637 (dadX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AJD40000
UniProt: A0A0B4WZQ7
LinkDB All DBs
Position
complement(626403..627527)
Genome map
AA seq 374 aa AA seqDB search
MILESRSQAALSSVGASGYLTIDLGALRRNYKLLSEMVAPAQTAAVVKANAYGLGADQVA
QALYSQGCRHFFVAQFVEAVHLRPNLPPEAQLFVLNGLQPGSEIRCAESRIIPVLNSLEQ
LQQWAGAARRLKRTLPAVLQFDTGMSRLGVQPKKRAELSASLREFGNVEILFIMSHLASA
DDAGSEQNGDQLAEMNRIADEFPGFDVCFANSGGIFLGNAFHGVLARSGIALYGGAPTAG
VANPMEAVVHLDVAVVQIQAVQAGARIGYSGAHVAEGEMRLATLAAGYADGLLRSLSGRG
AVYYDGVRLPIVGRVSMDSMTIDISALPEGTLTLGSFVEVLGPHQTLEDLARDAGTISYE
ILTGLGQRYHRRYR
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgattttggaatccagaagccaggcggccttaagctccgtgggagcttcgggctacctg
acgatcgatctcggtgcgctgcgccgcaactataagcttctgtcggaaatggtagcgccg
gcgcagacggccgccgtcgtcaaggccaacgcctatggtcttggcgccgaccaggtggcg
caagcgctctactcccaaggctgccggcatttcttcgttgcccagttcgtcgaagccgta
caccttcggcccaatctgccgcctgaggcccagctcttcgtcctcaacggtttgcagcct
ggaagcgaaattcgctgcgccgagagccgcatcatccccgttctcaactccttggagcag
ttgcagcaatgggctggcgcggcccgccgcctgaagcgcacgctaccggcggtattacag
ttcgacaccggcatgtcgagacttggcgtgcagcccaagaagcgggcggagctttcggcg
tcgcttagggaattcgggaatgtcgagatcttgttcatcatgagccatctcgcgtccgcc
gacgatgctggaagcgagcaaaatggcgaccagcttgccgaaatgaaccggatcgccgac
gagtttcccggcttcgacgtctgcttcgctaattccggcgggatctttctcggcaatgcc
tttcacggtgtgctcgcccgttccggaattgcgctttacggtggcgccccgactgcaggt
gttgcaaacccgatggaggcggtcgttcacctggatgtcgcggtggtgcagatccaggcg
gtccaggccggtgctcgtatcggctatagtggtgctcatgtcgcggagggcgaaatgcgc
cttgcgacgcttgcggcgggttatgccgacgggctgctgcgcagcctgagcggtcgtgga
gcggtttactacgatggcgtacgccttccgattgtcggccgagtttcgatggacagcatg
acaattgacatatctgccctgccggaaggcacgctaaccctcggcagcttcgttgaagtg
ctcggccctcatcagacgttggaagaccttgcccgcgacgccggcacaatctcctacgaa
atcttgaccggcctcggtcagcgctatcatcggcggtatcgctga

DBGET integrated database retrieval system