KEGG   Rhizobium gallicum: RGR602_CH01560Help
Entry
RGR602_CH01560    CDS       T03539                                 

Gene name
tuf-1
Definition
(GenBank) elongation factor Tu 1
  KO
K02358  elongation factor Tu
Organism
rga  Rhizobium gallicum
Brite
KEGG Orthology (KO) [BR:rga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:rga03012]
    RGR602_CH01560 (tuf-1)
   03029 Mitochondrial biogenesis [BR:rga03029]
    RGR602_CH01560 (tuf-1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rga04147]
    RGR602_CH01560 (tuf-1)
Translation factors [BR:rga03012]
 Eukaryotic Type
  Elongation factors
   RGR602_CH01560 (tuf-1)
 Prokaryotic Type
   RGR602_CH01560 (tuf-1)
Mitochondrial biogenesis [BR:rga03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    RGR602_CH01560 (tuf-1)
Exosome [BR:rga04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   RGR602_CH01560 (tuf-1)
  Exosomal proteins of breast cancer cells
   RGR602_CH01560 (tuf-1)
  Exosomal proteins of colorectal cancer cells
   RGR602_CH01560 (tuf-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-ProteinID: AJD40907
UniProt: A0A0B4X2W9
LinkDB All DBs
Position
1560686..1561861
Genome map
AA seq 391 aa AA seqDB search
MAKSKFERNKPHVNIGTIGHVDHGKTSLTAAITKYFGEFKAYDQIDAAPEEKARGITIST
AHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHILLARQ
VGVPAIVVFLNKVDQVDDAELLELVELEVRELLSSYDFPGDDIPVVKGSALAALEDSDKK
IGEDAIRELMAQVDAYIPTPERPIDQPFLMPIEDVFSISGRGTVVTGRVERGIVKVGEEV
EIVGIRPTSKTTVTGVEMFRKLLDQGQAGDNIGALIRGVNRDGVERGQILCKPGSVKPHK
KFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGIVTLPEGTEMVMPGDNVTVDVEL
IVPIAMEEKLRFAIREGGRTVGAGIVASIVE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagagtaagtttgagcgcaacaagccgcacgttaacatcggcacgatcggccac
gttgaccacggcaagacgtctctgacggcggcgatcacgaagtacttcggcgagttcaag
gcgtatgaccagatcgacgctgcgccggaagaaaaggctcgcgggatcacgatttcgacg
gcgcatgtcgagtatgagacggccaaccgccactacgcgcacgtcgactgccccggccac
gccgactacgtcaagaacatgatcaccggtgccgcacagatggacggcgcgatcctggtg
tgctcggctgccgacggcccgatgccgcagacccgcgaacacatcctgctcgcccgccag
gtcggcgttccggcaatcgtcgtgttcctgaacaaggtcgaccaggtcgacgacgccgag
cttctcgagctcgtcgagctggaagtgcgcgaactgctgtcgtcctacgacttcccgggc
gacgacatcccggttgtcaagggttcggcgttggctgctcttgaagattccgacaagaag
attggcgaagacgcgatccgcgaactgatggcccaggtcgacgcctacatcccgacgcct
gagcgtccgatcgaccagccgttcctgatgccgatcgaagacgtgttctcgatctcgggc
cgcggtacggtcgtgaccggccgcgtcgagcgcggtatcgtcaaggttggcgaagaagtc
gagatcgtcggcatccgcccgacctcgaagacgacggtgaccggcgttgaaatgttccgc
aagctgcttgaccagggccaggccggcgacaacatcggcgcactgatccgcggcgtgaac
cgcgacggcgtcgagcgtggccagatcctgtgcaagccgggttcggtgaagccgcacaag
aagttcaaggctgaagcctacatcctgacgaaggaagaaggcggccgtcatacgccgttc
ttcaccaactaccgtccgcagttctacttccgcacgacggacgtgacgggcatcgtgacg
ctgccggaaggcaccgaaatggtgatgccgggcgacaacgtcacggttgacgtcgagctg
atcgtgccgatcgccatggaagaaaagctgcgcttcgccatccgcgaaggcggccgcacc
gtcggcgccggtatcgttgcatcgatcgtagagtaa

DBGET integrated database retrieval system