KEGG   Rhizobium gallicum: RGR602_CH01829Help
Entry
RGR602_CH01829    CDS       T03539                                 

Gene name
pdhC
Definition
(GenBank) dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rga  Rhizobium gallicum
Pathway
rga00010  Glycolysis / Gluconeogenesis
rga00020  Citrate cycle (TCA cycle)
rga00620  Pyruvate metabolism
rga01100  Metabolic pathways
rga01110  Biosynthesis of secondary metabolites
rga01120  Microbial metabolism in diverse environments
rga01130  Biosynthesis of antibiotics
rga01200  Carbon metabolism
Module
rga_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RGR602_CH01829 (pdhC)
   00020 Citrate cycle (TCA cycle)
    RGR602_CH01829 (pdhC)
   00620 Pyruvate metabolism
    RGR602_CH01829 (pdhC)
Enzymes [BR:rga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     RGR602_CH01829 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N Peptidase_M23 HlyD_3 QRPTase_N
Motif
Other DBs
NCBI-ProteinID: AJD41161
UniProt: A0A0B4X1U7
LinkDB All DBs
Position
1811638..1812990
Genome map
AA seq 450 aa AA seqDB search
MEEGNLAKWLVKEGDTVKSGDVIAEIETDKATMEVEAVDEGTIAKIVVPAGTEGVKVNAL
IAVLAGEGEDVAAAASGAGSAAASSFEAKAQSASATRDEAGKGTAPAAALLAANANVSPH
PEVPLQAAPKGEGVTRTFSSPLARRLAKEAGIDLSTIAGSGPRGRVVKSDVETAVAGGGA
KAAPAAAAAQQAAAAPAPAPAAAKGAPEEAVLKLFEPGSYELVPHDGMRKTIARRLVESK
QTIPHFYVTVDCGLDALLALRSQLNDSAPRKDGAPAYKLSVNDMVIKALALALRDVPDAN
VSWTENNMVKHKHADVGVAVSIPGGLITPIVRKAEEKTLSAISNEMRDLGKRAKDRKLKP
EEYQGGTTSVSNMGMMGVKDFAAVVNPPHATILAVGAGEQRVIVKKGEMAIATVMSITLS
TDHRCVDGALGAELLQAFKGYIENPMSMLV
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaggcaatctggccaagtggctcgtcaaggaaggcgacaccgtcaagtccggc
gatgtgatcgccgagatcgagacagacaaggcgacaatggaagtcgaagccgtcgatgag
ggcacgattgccaagatcgtcgttccggccggtacggaaggtgtcaaggtcaatgcgctg
atcgcggttcttgccggcgaaggcgaggacgttgccgccgctgcaagcggcgcgggttcg
gctgctgcctcgtccttcgaagcgaaagcccaaagcgcttccgctactcgcgacgaggca
ggcaaaggcaccgcgccagccgctgccctgcttgccgcgaatgccaatgtgagccctcac
cctgaggtgccgctgcaggccgccccgaagggggagggcgtcacacgcaccttctcctcg
ccgctcgcgcggcgtctggccaaggaagccggtatagatctttccacaattgccggttcc
ggcccgcgcggccgtgtggttaagagcgatgtcgagaccgccgtcgccggtggtggcgct
aaagcggcgcccgctgctgcggcggctcagcaggctgctgcggctccggctccggcaccg
gctgcagccaagggtgcaccggaggaggctgtcctcaagctcttcgagccgggctcctac
gagctcgtgccgcatgacggcatgcgcaagacgattgcccgccgcctggtggaatccaag
cagaccatcccgcacttctacgtcaccgtcgattgcggactggatgcgctgctggcgctg
cgttcccagctcaacgattccgccccgcgcaaggatggtgccccggcctacaagctttct
gtcaacgacatggtcatcaaggcgcttgcgcttgcgctgcgagacgttccggacgcgaat
gtgtcctggaccgaaaataacatggtcaagcacaagcatgccgatgtcggcgtcgccgtc
tccattccaggcgggctgatcaccccgatcgttcgcaaggctgaagaaaagacgctgtcc
gccatctccaacgagatgcgtgatctcggcaagcgcgccaaggaccgcaagctgaaacct
gaggaataccaaggcggcaccacctcggtctcgaacatgggcatgatgggcgtgaaagac
ttcgcagccgtcgtcaacccgccacatgcgacgatccttgcggtcggcgccggcgagcag
cgtgtcattgtcaagaagggcgaaatggcgatcgcgacggtgatgagcatcacgctttcg
accgaccaccgttgcgtcgacggtgcgctcggcgccgagttgctgcaggccttcaagggc
tatatcgaaaacccgatgagcatgcttgtctga

DBGET integrated database retrieval system