KEGG   Rhizobium gallicum: RGR602_CH02715Help
Entry
RGR602_CH02715    CDS       T03539                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
rga  Rhizobium gallicum
Pathway
rga00240  Pyrimidine metabolism
rga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rga00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    RGR602_CH02715 (tdk)
Enzymes [BR:rga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     RGR602_CH02715 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30 AAA_22
Motif
Other DBs
NCBI-ProteinID: AJD42035
UniProt: A0A0B4X5S1
LinkDB All DBs
Position
complement(2697218..2697820)
Genome map
AA seq 200 aa AA seqDB search
MAKLYFNYSTMNAGKSTMLLQASYNYQERGMRTVLLIAAFDERTGKGIIGSRIGLEASAI
AFEGQTDLFGLIKELSGEGGPIACIFVDEANFMTREHVWQLARVVDRLNIPVMVYGLRTD
FQGKLFPASEELLAIADEMREVRTICHCGRKATMVVRLGADGEVAREGAQIEVGGNEKYV
SLCRRHWDDAMNGEWRAEAV
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactctatttcaactactctaccatgaacgccggcaaatcgaccatgctgctg
caggcgtcctataattaccaggaacgcggcatgcgcaccgtgcttttgatcgcagccttc
gacgagcgcaccggcaagggtatcatcggttcgcgcatcgggctggaagcgagcgcgatc
gctttcgaggggcagaccgatcttttcggactcatcaaggaactgagcggcgagggcggc
ccgatcgcatgcatcttcgtcgacgaagcgaatttcatgacgcgcgagcatgtctggcaa
ctcgcccgcgtggtagatcggctgaacataccggtcatggtctacgggcttcgcaccgac
ttccagggcaagctgtttcccgcttccgaggaactgctggcgattgcagacgagatgcgc
gaggtgcgcaccatctgccattgcggccgcaaggcgacaatggtcgtgcggctcggtgct
gacggcgaggttgcgcgcgagggcgcgcagatcgaagtcggcggcaacgagaaatatgta
tcgctctgccgcaggcattgggacgatgcaatgaatggcgaatggcgcgccgaggcggtt
tga

DBGET integrated database retrieval system