KEGG   Rhizobium gallicum: RGR602_CH03398Help
Entry
RGR602_CH03398    CDS       T03539                                 

Gene name
cbbT-1
Definition
(GenBank) transketolase 1
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
rga  Rhizobium gallicum
Pathway
rga00030  Pentose phosphate pathway
rga01100  Metabolic pathways
rga01110  Biosynthesis of secondary metabolites
rga01120  Microbial metabolism in diverse environments
rga01130  Biosynthesis of antibiotics
rga01200  Carbon metabolism
rga01230  Biosynthesis of amino acids
Module
rga_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
rga_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:rga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    RGR602_CH03398 (cbbT-1)
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    RGR602_CH03398 (cbbT-1)
Enzymes [BR:rga01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     RGR602_CH03398 (cbbT-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C E1_dh DXP_synthase_N TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: AJD42706
UniProt: A0A0B4X6D3
LinkDB All DBs
Position
3432855..3434828
Genome map
AA seq 657 aa AA seqDB search
MTSPEQHDRMANAIRFLSMDAVEKANSGHPGLPMGMADVATVLFTKYLNFDPKQPHWPNR
DRFVLSAGHGSMLLYSLLYLTGYPDMSIEDIRNFRQLGYKTAGHPEYGHATGIETTTGPL
GQGIANSVGMAIAERKLREEFGSDLLDHYTYVIAGDGCLMEGVSQEAIALAGHLKLNKLI
VFWDNNSITIDGAVSLSDSTDQVARFKAAHWNTIEVDGHDQAAVAAAIEAAQKSDRPTLI
ACKTIIGFGAPNKQGTHKVHGNPLGADEIAATREALNWDAEAFTVPADILEAWRKAGTRS
AETITAWEGRLAASDKKAEFTRRFAGELPPGFDAAISEYKKKLAETKPTVATRKASEDAL
EVINGFLPETLGGSADLTPSNNTKTSQMKSITPTDFSGRYMHYGIREHGMAAAMNGISLH
GGLIPYGGGFLIFSDYCRPPIRLASLMGIRVIHVLTHDSIGLGEDGPTHQPVEQLAALRA
VPNLMIFRPADATETAECWQIAITTPNRPSGLALTRQNLSAVRTEYSEENLSAKGAYTLA
GSDDAKVTIFASGSEVEIAIAARATLEGKGVSTRVVSVPCTELFFEQPEAYRNAVLGKSP
VKIAVEAAVREGWDAFIGPAGTFIGMKSFGASGPYKELYKHFGITAEAVVAAAEAKL
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgacctctcccgaacaacatgaccggatggcgaatgcgatccgttttctctccatggat
gccgtcgaaaaggcaaattcgggccatccgggcctgccgatgggcatggcggatgtcgcc
accgttctctttacgaaatatctgaacttcgatcccaagcagccgcactggccgaaccgc
gaccgcttcgtgctgtcggccggtcatggctccatgctgctttattcgctgctttatctg
accggttatccggacatgtcgatcgaggacatcaggaatttccgccagctcggctataag
acagccggccatccggaatacggccatgcgaccggtatcgaaaccaccaccggcccgctc
ggccagggtatcgcgaattcggtcggcatggcgatcgccgagcgcaagctgcgcgaggag
ttcggctccgacctgctcgaccactacacctatgtgatcgccggcgacggctgcctcatg
gaaggcgtcagccaggaagccatcgcgctcgctggccacctgaagctcaacaagctcatc
gtcttttgggacaacaattcgatcaccatcgacggcgccgtatcgctgtcggattcgacc
gaccaggttgcgcgctttaaggcagcgcactggaacacgatcgaagtcgatggtcatgac
caggctgccgttgccgccgctatcgaagccgcgcaaaaatccgaccgtccgacactgatc
gcctgcaagacgatcatcggcttcggcgcgccgaacaagcagggcacccacaaggtgcac
ggcaacccgctcggcgcagatgaaatcgccgctacccgcgaggccctgaactgggacgcc
gaagccttcaccgtcccggccgacattctggaagcctggcgcaaggcgggcacccgttct
gccgaaaccatcacggcctgggagggccgcctcgctgcctccgacaagaaggccgagttc
acccgccgctttgccggcgaattgccgcccggcttcgatgcagcgatcagcgagtacaag
aagaagcttgccgaaaccaagccgacggtcgcgacccgcaaggcttcggaagatgcgctc
gaagtcataaacggcttcctgccagaaacgctcggcggctccgccgacctgacgccctcg
aataacaccaagaccagccagatgaagtcgattaccccgaccgacttctccggccgctac
atgcattacggcatccgcgaacacggcatggcggccgccatgaacggcatctcgctgcac
ggcggcctgatcccctacggcggcggcttcctgatcttctcggattattgccgcccgccg
atccgcctcgcctcgctgatgggcatccgcgttatccacgtgctgacgcacgactcgatc
ggcctcggggaagatggcccgacgcaccagccggtcgaacagctcgccgcactgcgcgcc
gttccgaacctgatgatcttccgccctgctgatgccacggaaaccgccgaatgctggcag
atcgccatcacgacgccaaaccgtccgtcgggcctggcgctcacccgccagaacctttcg
gccgtgcgcaccgaatacagcgaggagaacctctcggcaaagggcgcctacacgctcgcc
ggctccgatgatgccaaggtcacgatcttcgcatcgggctccgaggtcgagatcgccatc
gccgcgcgcgccacgctggaaggcaagggcgtttccacccgcgtcgtctccgttccctgc
accgaactcttcttcgagcagccggaagcctaccgcaatgcggtcctcggcaagtcgccg
gtcaagatcgccgtcgaagccgccgtccgcgaaggctgggacgcctttatcggcccggca
ggtacctttatcggcatgaagagcttcggcgcctccggcccgtacaaggaactctacaag
catttcggcatcacggcggaagccgttgtcgccgcagcagaagccaaactctaa

DBGET integrated database retrieval system