KEGG   Rhizobium gallicum: RGR602_CH03630Help
Entry
RGR602_CH03630    CDS       T03539                                 

Gene name
glpD-1
Definition
(GenBank) glycerol-3-phosphate dehydrogenase 1
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
rga  Rhizobium gallicum
Pathway
rga00564  Glycerophospholipid metabolism
rga01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rga00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    RGR602_CH03630 (glpD-1)
Enzymes [BR:rga01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     RGR602_CH03630 (glpD-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AJD42937
UniProt: A0A0B4X8U4
LinkDB All DBs
Position
complement(3681666..3683183)
Genome map
AA seq 505 aa AA seqDB search
MGQTHHDLFVIGGGINGCGICRDAAGRGYSVALAEMGDFASGTSSGATKLIHGGLRYLEH
YEFRLVRESLMEREVLWAMAPHIIWPLRFVLPYHKGGIRPAWLIRLGLFFYDHLGGRRLL
PPTAVLNLRRDPAGRPLKPVFAKAFEYSDGWVDDARLVVLNARDAADRGALIMPRTKVVA
ARRKNGLWEIDSCDILSGERRRHQARMLVNAAGPWVDQVLRAALGETEARHVRLVQGSHI
VVKKKFEGPRAYFFQNPDNRIIFAIPYEDDFTLIGTTDRDYSGDPKDVRITAEETGYLCA
AASEYFNAPVTPDDIVWSYSAVRPLYDDGASKAQEATRDYVLQLEGKGGEAPLLNVFGGK
LTTYRRLSEHALEKIGEAIGTKGGPWTARSHLPGGDFPVKGYAAEVSRLKADYPFLAEAH
ARRLVRRYGTRAASLLAEAKSIADLGHCFGSDLYEVEVRYLVRNEWAVTAQDILWRRTKN
GLYLQMDEVQKLEEYMAAIPAQLAG
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
gtgggccaaacacatcacgaccttttcgtgattggcggcgggatcaacggctgcggcatt
tgccgggatgctgctggacgcggctattctgtggcgctggcggagatgggcgactttgcc
tctggcacgtcgtctggggcgacgaagctgatccatgggggcttgcgctatctggagcat
tacgagttccggctggtgcgcgaatcgctgatggagcgcgaggtgctttgggcgatggcg
ccgcacatcatctggccgctgcgcttcgtgctgccctatcacaagggtggcatccggccg
gcctggctgatcaggctggggctgtttttctacgaccatcttggcggccgcaggcttttg
ccgccgaccgccgtgctgaacctgcgccgcgatccggcgggccggccgctcaagccggtg
tttgccaaggccttcgaatattccgacggctgggtcgacgatgcccgcctggtggtgctc
aacgcccgcgatgccgccgaccgcggtgcgctgatcatgccgcgcaccaaagtggtggcg
gcgcggcgcaagaacggcctgtgggaaatcgacagctgcgatatactgagcggcgaaagg
cgtcggcatcaggcccgcatgctggtcaatgccgccggtccctgggtcgaccaggtgctg
cgtgcagcccttggcgagaccgaggcccgccatgtgcgcttggtgcagggcagccacatc
gtcgtcaagaagaagttcgaggggccgcgggcctatttcttccagaatcccgacaaccgc
atcatcttcgccatcccctacgaggacgacttcacgctgatcggcaccaccgaccgcgac
tatagcggcgatcccaaggacgtgcgcatcactgcggaggagaccggctatctctgcgcc
gccgccagcgagtatttcaacgcaccggtgaccccggacgacatcgtctggagctattcg
gcggtgcggccgctctatgacgacggcgcctcgaaggcacaggaggcgacgcgcgactat
gtgctgcagctcgaaggcaaaggtggcgaggcgccgctgctcaatgtcttcggcggcaag
ctgaccacctaccggcggctgtcggagcatgcgctggaaaagatcggcgaggcgatcggc
acgaagggcggcccgtggacagcgaggagccatctgccgggcggcgatttcccggtcaag
ggctatgcggccgaggtgagcaggctgaaggctgactatccgttccttgccgaggcccat
gcccgccggctggtgcgccgctacggcacgcgcgccgcgagcctgcttgcagaggctaaa
tctatcgccgatctcggccactgcttcggttccgatctctacgaggtcgaggtccgctat
ctcgtccgcaacgaatgggccgtcaccgctcaagacatcctgtggcgaaggaccaagaac
gggctatatctgcagatggatgaagtacagaaattggaggagtacatggccgcgatccct
gcgcaacttgcgggatga

DBGET integrated database retrieval system