KEGG   Rhizobium gallicum: RGR602_PA00069Help
Entry
RGR602_PA00069    CDS       T03539                                 

Definition
(GenBank) transketolase-like protein
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
rga  Rhizobium gallicum
Pathway
rga00030  Pentose phosphate pathway
rga01100  Metabolic pathways
rga01110  Biosynthesis of secondary metabolites
rga01120  Microbial metabolism in diverse environments
rga01130  Biosynthesis of antibiotics
rga01200  Carbon metabolism
rga01230  Biosynthesis of amino acids
Module
rga_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
rga_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:rga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    RGR602_PA00069
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    RGR602_PA00069
Enzymes [BR:rga01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     RGR602_PA00069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr TPP_enzyme_C DXP_synthase_N E1_dh DUF1525 GH114_assoc
Motif
Other DBs
NCBI-ProteinID: AJD43415
UniProt: A0A0B4X9L1
LinkDB All DBs
Position
pRgalR602a:67685..69559
Genome map
AA seq 624 aa AA seqDB search
MTAAVSIRDLASAIRVLSIDAVEAAKSGHPGMPMGMADAAAVLFGRHLKFDPIEPGWPDR
DRFVLSNGHGSMLLYSLLHLTGYEDMTIEEVRNFRQWGSKTPGHPEYGHTAGVEATTGPL
GQGIASAVGMAIAERRLSTEFGAALVDHRTYVFCGDGCLMEGVGQEAASLAGHLQLGKLI
VLYDDNSITIDGSTAIAFSEDVLARFDAYGWHTQRVDGHDPDAIDAAISQAKAEASRPSL
IALKTIIGYGSPSRAGTSSVHGAPLGASEAVATKAAYGWTADAFEIPAPILKTWREVGAK
GAKARKDWQARLEAAGADVRSEFQRRTAGSLPARYEEAVNAAKAKLLDKPQSVATRKASQ
IALEALTELLPEMIGGSADLTHSNLTRVPAVDSDFTAAAGGRYVSYGVREFAMAAAMNGM
AAHGGVIPYGGTFLVFSDYCRNAIRVAALMGVRSIFVMTHDSIGLGEDGPTHQPVEHLAS
LRAMPNLHVFRPADTIETLECWDLAITSKNTPSVLALSRQNVPQLRTERDGIAAHGEPMC
CGKPAANVPSQSSPPERKSRLRSRLPRSLRRETFPPLSSRYRAGISSNSSPRITAARSSA
TRRALPWKRSRSSGGPGMSTAKRT
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
ttgacagcagcagtttcgatccgcgatctcgcgagcgctatccgagtcctgtcaatcgac
gcggttgaggccgcaaagtccgggcaccccggaatgcccatgggtatggctgatgcggcg
gcggtgctgttcggccggcacctcaagttcgatccaatcgaacctggctggccggaccgc
gatcgtttcgtcctgtcgaacggccatggctcgatgctgctctacagccttctgcacctc
accgggtacgaagacatgacgattgaggaggttcgcaacttccgccaatggggctccaaa
acgccaggtcatcccgaatacggccacaccgctggtgtcgaggcgaccaccgggccgctc
ggacaggggatcgcgtcggctgtcggaatggcgatcgcggagcggcgcctatcaacggaa
tttggcgcagcacttgtcgatcaccggacctacgtcttctgtggagatggatgtctcatg
gaaggcgttggtcaggaagctgcttcgctggccggccaccttcagctcggcaagttgatc
gtcctttacgacgataactccattaccatcgacggctcgaccgcaatcgcgttttcggaa
gatgtgctcgcgaggttcgacgcatacggatggcacacacagcgcgttgacggtcatgat
ccggacgcgatcgacgcggcgatctcgcaggcgaaggcggaagcatccagaccatccctc
atcgctctgaaaaccatcatcggatacggctctccgtcaagggcgggaacaagctccgta
catggtgcaccgctcggcgccagcgaagccgtcgcgacaaaggcagcctatggctggacg
gcggacgctttcgagattcctgctccgatcctcaagacttggcgcgaagtcggcgcgaag
ggtgccaaggcgcgcaaggactggcaagcgcggctcgaagcagcgggcgcagatgtcaga
agtgagtttcaacgccgcaccgccggctcattgccggcgcgatacgaagaagcggtgaac
gccgccaaggcaaagctactcgacaagccgcaatcagtggcaacgcgtaaggcaagccag
atcgcactggaagcgctgacggagctgcttcccgaaatgatcggcggttccgctgacctc
acccactctaatctgacccgggttccggccgtggacagcgatttcaccgccgctgcaggc
gggcggtatgtcagctatggcgtgagggagttcgccatggccgccgcgatgaacggcatg
gcggctcacggcggtgtcataccctatggcggcacgttccttgtcttctccgattattgc
cgcaacgccattcgtgttgcggctctgatgggcgtccgctctatcttcgtgatgacgcat
gactcgatcggtcttggcgaagacggtccgacgcaccagcccgtcgagcatcttgccagc
ctcagggcaatgccgaacttgcatgtatttcggcccgccgacaccatcgagacgctggaa
tgctgggatcttgcaataaccagcaagaacacgccgtcggttttggcgctctcgcggcag
aatgttccgcaactgcgcaccgagcgtgacggcatcgctgcgcacggggagcctatgtgc
tgcgggaagccagcagcgaacgtgccgtcacaatcatcgccaccggaacggaagtcgcgc
ttgcgatccaggctgccgaggagcttgaggcgagaaacattcccgccgctgtcgtctcga
taccgagctgggatctcttcgaacagcagcccaaggattaccgcagctcggtcctcggca
acgcgccgcgcattgccgtggaagcgctctcgaagttcgggtggaccaggtatgtcgaca
gcgaagaggacgtga

DBGET integrated database retrieval system