KEGG   Rhizobium gallicum: RGR602_PC00356Help
Entry
RGR602_PC00356    CDS       T03539                                 

Definition
(GenBank) glycosyde hydrolase family 15 protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
rga  Rhizobium gallicum
Pathway
rga00500  Starch and sucrose metabolism
rga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RGR602_PC00356
Enzymes [BR:rga01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     RGR602_PC00356
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: AJD44396
UniProt: A0A0B4XBE0
LinkDB All DBs
Position
pRgalR602c:complement(379787..381220)
Genome map
AA seq 477 aa AA seqDB search
MTVALWSQPVADPAYGPTIGAYAPAVKPAPAFAQTDLVALSRYFSLLMMRNITSDGYVIE
DPASSSVFSVPGCVIAAPSYPANTPGVDQDYVFNWVRDGAITAIEIALAGLRLVPGGGVP
SLIDYVNFAALCQANAKNSATVTLGHACFTITGEVRPWSEQNDGPAIQSIAILTLFDQLD
GATQTIAKQLVETNLAYLLEVYQNKTTNLWEEYEGYSFFARAVQLRFFREIARNTIGIAV
PAGVADAISWLEIQLATHWNGQLYVSVLDAAAQAGYDANIDIVSSVCYGGIEPTDTKLLA
TAAILRRQWADPSSSNYYPINGADAAKGLGPLFGRYPGDHYDGDVAAPVVGGHPWALCTA
NFAEFQYRLANAIEASSAIPLDQFSEPFFAELGLGASSSAADASVALRASSDLMLRAIVY
HSDHYELSEQFDGTTGYEKSVRNLTWSYASFLSAVRARSAGALAAKAKPRKSRVPRS
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgacagttgcattatggagtcagccagttgcggacccggcctatggcccgactatcggc
gcttatgcgcctgcagtcaaaccggcgcccgccttcgcgcagaccgatctggttgcattg
tcgcgctatttttctcttctgatgatgcgcaacatcacaagcgatggctatgtcatcgag
gatccggcatcgtccagcgtcttttcggtcccgggctgcgtcatcgccgcaccctcctat
ccagcgaacacgccgggtgtcgaccaggactatgttttcaactgggtccgcgatggagct
attacggccatcgagatcgcgctcgccggcttgcggctcgttccgggtgggggtgtgccg
agcctgatcgactacgtgaacttcgccgcgctctgtcaggcgaatgcgaagaattccgcg
actgtcacacttggccatgcctgcttcaccatcactggtgaggttcgtccgtggtcggag
cagaatgacgggccggccattcagtcgattgcgatcctgaccttgttcgatcagctggat
ggtgccacgcagacaatcgccaaacaattggtcgagactaacctcgcctatcttctcgaa
gtttatcagaacaagaccacaaatctctgggaggaatatgagggctattcctttttcgca
agagccgtacagttgcgctttttccgggaaattgccagaaacacgattggcattgcggtg
cctgccggggtggccgatgccatctcttggctggaaatccagctggctacccactggaat
gggcagctctatgtgagcgttctggatgccgcagcgcaagccggttacgacgccaacatc
gatatcgtctcttcggtctgctatggcgggatcgagccgaccgataccaagcttctggca
acggcggccatcctgcggcgccagtgggccgatccttcgtcttcgaactattacccgatc
aatggcgccgacgcggccaaaggactcggtccactcttcgggcgctatccaggcgaccat
tacgatggcgatgtggcggctccggtggtcggcgggcatccctgggctctgtgcacggct
aacttcgccgagtttcaatatcggcttgccaatgccatcgaggccagcagcgccatccct
ctcgatcagttttctgaacccttcttcgcggaactgggtcttggcgcatccagcagcgcc
gccgacgcgtcggttgccttgcgggcttcgtctgacctcatgctgcgcgccatcgtctat
cacagcgatcactatgaactgagcgaacagttcgatggaaccactggctatgagaaaagc
gtccggaacctgacctggagctacgcctcttttctctctgcagtcagagcccgctccgcc
ggcgccctggccgccaaggccaaaccccgaaagtcgcgcgtcccaagatcatga

DBGET integrated database retrieval system