KEGG   Rhizobium gallicum: RGR602_PC00449Help
Entry
RGR602_PC00449    CDS       T03539                                 

Definition
(GenBank) xylose isomerase domain-containing protein
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
rga  Rhizobium gallicum
Pathway
rga00040  Pentose and glucuronate interconversions
rga00051  Fructose and mannose metabolism
rga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    RGR602_PC00449
   00051 Fructose and mannose metabolism
    RGR602_PC00449
Enzymes [BR:rga01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     RGR602_PC00449
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AJD44489
UniProt: A0A0B4X935
LinkDB All DBs
Position
pRgalR602c:complement(481735..482754)
Genome map
AA seq 339 aa AA seqDB search
MHHFTDGTDALNPTRFATRLNSFASAAHREWPGQPTKPSVVQMANRAARVKGLTDLDLNY
PDHVTENPKELSQRLSNLGLSINGFAMRYYTNPAFKLGAFTHPDEVVRREAIDLTKKGID
AAREAGSSLMTIWLGQDGFDYAFQVDYEKMWQHEIDGIREVCEHDPDCLISIEYKPNEPR
SYSLMPDAATTLLAIKDVGAKNLGVTLDFAHVLYADEQPAFAAAMIARHSRVLGVHLNDG
YAKRDDGLMVGAVHTLQTIELLRQIRRDGYDGAIYFDTFPDMTGLDPVHECEVNIKTVQR
MLKVVDRLEQDNRLASAIVRQDAVSTQAIVQELMFGAEH
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
gtgcatcacttcacagatgggactgatgccttgaacccgacacgctttgccacccgcctc
aattcatttgcttctgccgctcaccgggaatggccgggccagcctacaaagccgtcggtc
gtgcagatggccaaccgcgccgcccgggtgaaaggactgaccgacctcgacctgaactac
cccgaccacgtgactgagaatccaaaggaactttcgcaaaggctcagcaatctcggactt
tcgatcaatggcttcgctatgcgctactatacaaatcctgccttcaagctcggcgccttc
acacatccggatgaagtcgtccggcgcgaggcgatcgatctgacgaagaaagggatcgat
gccgcccgtgaagccgggtcgagcttgatgacgatatggctcggccaagacggcttcgat
tacgcattccaagtcgattatgagaagatgtggcaacacgaaatagatggtatccgtgaa
gtttgcgagcacgatcccgattgcctgatctcgatcgagtataagccgaacgagccccgc
tcgtatagcctgatgcccgatgcggccacgacgttgctcgccatcaaggatgtcggcgca
aagaatctgggcgtcacgctcgacttcgcgcatgtcctctacgccgatgagcagcctgca
ttcgctgccgccatgatcgcccgccacagccgcgtgctcggtgtccatctcaatgacggc
tatgcgaagcgcgacgacgggctgatggtcggggcagtccatacccttcagacgatcgag
ttgctccgccagatcaggcgcgacggctacgacggcgcgatttatttcgacacgttccca
gatatgaccgggctcgatccggttcacgaatgcgaggtcaacatcaagactgtccagcgg
atgttgaaggtcgttgaccgcctcgagcaggacaatcgtctcgcaagcgcgattgtccga
caggacgccgtttctacgcaggccatcgtacaggagctgatgttcggcgcggagcactga

DBGET integrated database retrieval system