KEGG   Rhizobium gallicum: RGR602_PC00617Help
Entry
RGR602_PC00617    CDS       T03539                                 

Definition
(GenBank) ATP-dependent DNA ligase protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
rga  Rhizobium gallicum
Pathway
rga03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:rga00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    RGR602_PC00617
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rga03400]
    RGR602_PC00617
Enzymes [BR:rga01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     RGR602_PC00617
DNA repair and recombination proteins [BR:rga03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     RGR602_PC00617
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M CTK3_C
Motif
Other DBs
NCBI-ProteinID: AJD44656
UniProt: A0A0B4XC15
LinkDB All DBs
Position
pRgalR602c:654261..656903
Genome map
AA seq 880 aa AA seqDB search
MASDKLSTYRSKRDFQRTAEPSGEGRIARSNRPRFVIQKHDATRLHYDLRLEFDGVFKSW
AVTKGPSLDPHDKRLAVEVEDHPLDYGDFEGTIPKGQYGGGTVMLWDRGYWKPEGKKSPK
QALEKGDFKFTLEGKRLHGGFVLVRMGNDRERGKRTNWLLIKHHDAFSVEENGAAILEEN
DTSVASGRTMEMIAAGKGRKPKPFIVAGGDVQADAVWDSHQGLAADERKSDVRAGKASVS
PVDLPDFVAPQLCQTLKRPPVGKGWIHEIKFDGYRIQMRVLDGEATLKTRKGLDWTAKYR
EIGEAASALPDSIIDGEICALDENGAPDFAALQAALSEGKAGDLVYFAFDLLYDGGEDLR
SLSVADRKARLQSLLAEAGDNPRIRFVEHFETDGDAVLRSACKLSLEGIISKQVDAPYQS
GRTETWAKSKCRAGHEVVLGAYAKTNGKFRSLLVGVYHGDHFVYVGRVGTGYGAKKVETL
LPKLKALETTNSPFTGIGAPKKGAEVTWLKPELVAEIEFAGWTADGLIRQAAFKGLRDDK
PAKEVVAERPANPSKTDLPGPALVATAARSTRRKGVKADVMGVLISNPDKPLWPDANDKG
SVTKEELARYYEAVGSWMIEHIKGRPCSIIRAPDGIGGEQFFQRHAMPGTSRLLELVKVF
GDKKPYLQIDRIEGLAAVAQIGAVELHPWNCEPQQPEVPGRLVFDLDPGPDVPFSTVVSA
ARDMRDRLEELGLISFCKTTGGKGLHVVTPLAINKRKPLSWSQAKAFAHAVCQQMARDNP
ELYLIKMTKSLRNGRIFLDYLRNDRMATAVAPLSPRARSGATVSMPLTWTQVKSDLDPKR
FTVRTVPALLAKTSAWQGYCDAQRPLEQAIKRLGKTTAAA
NT seq 2643 nt NT seq  +upstreamnt  +downstreamnt
atggccagtgataaactatcgacctatcgatcgaagcgcgattttcaaaggacggctgag
cccagcggtgaagggcgcattgcgcgcagcaatcgccctcgtttcgtcatccagaaacac
gacgcgacccgccttcactatgatctgaggctcgagttcgatggggtcttcaagtcctgg
gccgtcacgaaaggcccgtctctcgacccgcacgacaagcgattggcggtcgaggtggag
gaccacccactagattatggcgatttcgaagggactatcccgaaaggccagtatggcggc
ggtactgtgatgctatgggaccgtggctattggaagccggaaggaaagaagagcccgaag
caagctctggaaaagggcgacttcaaattcacccttgaaggcaaacgcctgcatggcggc
ttcgtgctggtgcgcatgggcaacgatcgcgaacgtggtaagcgaaccaactggctgctg
atcaagcaccatgacgccttctcggtcgaggagaatggcgcggcgatcctggaggagaat
gacacatcagtcgcctccggccgaacaatggagatgatcgccgctggcaaagggcgcaag
cccaaaccattcatcgtcgcgggaggcgacgttcaggctgatgcggtctgggacagccat
caagggctggccgctgacgagcgaaaatcggatgtgcgagccggcaaggcgtcggtttcg
cctgtcgacctgcctgatttcgtcgcgccacagctctgtcagaccctgaagcgccctccc
gtgggcaagggctggatccacgagatcaagttcgacggttaccggatccagatgcgcgtg
ctggacggtgaggcgacactgaagacccgaaagggcctcgactggacagccaaatatcgc
gaaataggcgaggcggcatctgcactgcccgattcaattatcgatggtgagatctgcgcc
ctcgacgagaatggtgcgcccgatttcgcggctctgcaggcggcgctttcggaaggcaaa
gccggggatctcgtctacttcgcattcgatcttctctacgacggtggtgaggatttgcga
tctctgtcagttgcggatcggaaggcgcggttgcagagcctgctggcggaggcaggcgac
aatccccgcatccggtttgtcgagcatttcgagactgacggcgacgcggtcctcagatct
gcctgcaagctgtcgctggaaggcatcatctcaaaacaggtggacgcgccgtaccaatcc
ggccgaacagagacctgggccaaatccaaatgtcgcgccggccacgaggtcgtgctcggc
gcttatgccaagacgaatggcaagttcagatccttgttggtcggcgtctaccacggcgac
cacttcgtctatgtcggccgcgtcggtacgggatatggcgcgaagaaagtggaaacgctg
cttccgaagttgaaggcgctcgagacgacgaattcgccctttactggcatcggcgcgccg
aagaagggggcggaagtgacttggctgaagcccgaactcgtggcggaaatcgaattcgca
ggctggaccgccgacggccttatccgccaggctgcttttaagggactgcgcgatgacaag
ccggccaaggaagtcgtggccgaacggccggcgaatccttctaaaaccgacctgccgggg
ccggcgctggtagccacggcggccaggtcgacgcgacggaagggtgttaaggcggacgtg
atgggcgtgctgatctccaacccggacaagccgctgtggccggatgccaatgacaaggga
tccgtcaccaaggaagagttggcccgctattacgaagccgtcggctcctggatgatcgag
cacatcaaagggcggccctgctccattatccgcgcccccgacgggatcggtggcgagcag
tttttccagcgacatgccatgcctggcacctcgaggcttctcgaactggtcaaggtcttc
ggtgacaagaagccatatctgcagatcgaccggatcgagggtttggctgccgtcgctcag
atcggcgctgtcgaactgcatccttggaattgcgagccgcagcagccagaagtgccaggg
aggctcgtctttgacctcgatcctggtccggacgtgcccttttccaccgtcgtttcggcg
gcccgcgatatgcgtgacaggcttgaggaactcggcttgatcagtttctgcaagacaact
ggcggcaagggccttcatgtggttaccccgcttgccatcaataaacgcaagccgctctcc
tggtctcaggcgaaagcgtttgcgcatgccgtctgccagcaaatggcgcgcgacaatccc
gagctctatctgatcaagatgaccaagagcttgaggaacggtcggatattcctcgactat
ctgcgcaatgaccgcatggcgacggcggttgcaccattgtcaccacgggcccggtccggc
gccaccgtctcgatgccgctgacatggacgcaggtcaaatccgacctcgatccgaagcga
ttcacggtcagaactgtgccggctctgctcgcaaagacatcggcttggcagggctattgt
gatgcccagcggccgctggagcaggcgattaagcgtttgggcaagacaacagccgccgca
tga

DBGET integrated database retrieval system