KEGG   Rhizobium gallicum: RGR602_PC01115Help
Entry
RGR602_PC01115    CDS       T03539                                 

Definition
(GenBank) aldehyde dehydrogenase (NAD(+)) protein
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
rga  Rhizobium gallicum
Pathway
rga00010  Glycolysis / Gluconeogenesis
rga00620  Pyruvate metabolism
rga01100  Metabolic pathways
rga01110  Biosynthesis of secondary metabolites
rga01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RGR602_PC01115
   00620 Pyruvate metabolism
    RGR602_PC01115
Enzymes [BR:rga01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     RGR602_PC01115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: AJD45146
UniProt: A0A0B4XDH7
LinkDB All DBs
Position
pRgalR602c:complement(1166446..1167954)
Genome map
AA seq 502 aa AA seqDB search
MLHQKIVEAPFKSKYGNFIGGEWREPIEGKYFDNITPVTGGKLCEIARSDEKDVNAALDA
AHAAKDKWAKTSPAERSNILMKIAQRMEDKLELLAQAETWDNGKPIRETMAADIPLAIDH
FRYFAACIRAQEGSIGEIDHDTVAYHFHEPLGVVGQIIPWNFPILMAAWKLAPALAAGNC
VVLKPAEQTPASILVWAELVGDLLPPGVLNIVNGFGLEAGKPLAASPRIAKIAFTGETST
GRLIMQYASQNLIPVTLELGGKSPNIFFADVMAEDDDFLDKALEGFAMFALNQGEVCTCP
SRALVEESIYDRFMERAVKRVEAIKQGNPLDSATMIGAQASNEQLEKILAYLDIGKQEGA
EVLAGGTRNDLGGELANGYYVKPTILRGHNRMRIFQEEIFGPVVSVTTFKNEKEALEIAN
DTLYGLGAGVWTRDGSRAYRFGREIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRETHKMM
LDHYQQTKNMLVSYSPKALGFF
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgctgcatcagaagatcgtcgaagcgccgttcaagtcaaagtacggcaacttcatcggg
ggcgagtggcgcgagccgatcgaaggcaaatacttcgacaacatcacgccggtgacaggc
ggcaagctttgcgaaattgcacgttccgacgaaaaggacgtcaacgcggcgctcgatgcg
gcccatgcggcgaaggataaatgggccaagacttcgcctgccgaacgctcgaatatcttg
atgaagatcgcccagcgcatggaggacaagctggaattgctcgcccaggccgagacgtgg
gacaacggcaaaccgatccgcgagacgatggcggccgacattccgcttgccatcgaccac
ttccgttattttgctgcctgcatacgtgcacaggaaggctcgatcggcgaaatcgaccac
gacaccgtcgcctatcacttccacgagccgcttggcgtcgtcggccagatcattccttgg
aacttccccatcctgatggcggcctggaagcttgctccggcccttgcggcgggcaattgc
gtggttctcaagccggccgaacagacaccagcgtccattcttgtatgggccgaactcgtc
ggcgatctgctgccgccaggcgtcctcaatattgtcaacggttttggcctggaagccggc
aagccgcttgcggccagcccgcgcatcgccaagatcgccttcacgggcgagacctcgacc
gggcgactgatcatgcaatatgccagccagaacctcatccccgttaccctcgaactcggc
ggcaagtcgccaaatatcttcttcgccgacgtcatggccgaagacgacgatttccttgac
aaggcgctggaaggttttgcgatgtttgctctaaaccagggcgaagtctgcacctgcccc
agccgcgccctggttgaggaatcgatctatgaccgcttcatggaaagggccgtcaagcgc
gtcgaagccatcaagcagggcaacccgctcgacagcgcgacgatgatcggcgcgcaggca
tcgaacgaacagttagagaagatcctcgcctatctcgacatcggcaagcaggaaggcgcc
gaagtcctggcggggggcacgcgcaatgatctcggcggcgaacttgccaatggctattat
gtcaaaccgacgatcctcaggggccataacagaatgcgcatcttccaggaagagatcttc
ggcccggtggtatcggtcacgaccttcaagaatgagaaggaagcgctggagatcgccaac
gacactctttacggcctgggagcaggcgtttggacgcgtgacggaagccgcgcctaccgc
ttcggccgcgagatccaggcggggcgcgtctggacgaattgctaccacgcctatccggca
catgcggccttcggcggctacaagcagtctggtatcggccgcgaaacacataagatgatg
cttgaccattaccagcagaccaagaacatgctcgtgagctacagcccgaaggcgctcggc
ttcttctga

DBGET integrated database retrieval system