KEGG   Rubrivivax gelatinosus: RGE_02320Help
Entry
RGE_02320         CDS       T01803                                 

Gene name
glpD
Definition
(GenBank) putative glycerol-3-phosphate dehydrogenase GlpD
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
rge  Rubrivivax gelatinosus
Pathway
rge00564  Glycerophospholipid metabolism
rge01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rge00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    RGE_02320 (glpD)
Enzymes [BR:rge01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     RGE_02320 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Trp_halogenase FAD_binding_3 Pyr_redox_2 Thi4 Lycopene_cycl HI0933_like NAD_binding_8 GIDA Pyr_redox Pyr_redox_3 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: BAL93577
UniProt: I0HKP0
LinkDB All DBs
Position
complement(240169..241746)
Genome map
AA seq 525 aa AA seqDB search
MKPANEDRARRWARLAERRDWDLVVVGGGATGLGVALDAAARGFSVALVESHDFAQGTSS
RATKLVHGGVRYLAQGNVHLVREALHERAAMLANAPHVAQPLPFVMPGYHWWERGFYGTG
LKLYDALAGARGLGATEWLGSARVQALLPGVQPRGLWGGVKYWDGQFDDARYAVLLARTA
AARGAVVLNHCAATALLRRDGRVHGVVVRDAETGAEATLSARCVVNAAGVWVDTLRDLDR
DDQAPARAPLVAPSQGVHLVVDRRFLPGTHALLVPKTADGRVLFAVPWLGKTILGTTDTP
REDLAREPQPFPAEVDFILRESARYLQQAPRREDVRSVWVGLRPLVRHDGEAGDTKALSR
EHTVLVAASGLVTVTGGKWTTYRAMAEDVLDRCMAQGLLPRRPAGATARLQLVGAAPGRS
LAAPPGEHLYGSEAATLRALPGAERWLWRDGDGGLSEAMVRFAARHEAARTVEDVLARRS
RLLFLDAAEAGRLAGAVAAILGDELERELDPAPFEALAARYTRLP
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacccgccaacgaggaccgcgcgcgccgctgggcgcgcctcgccgagcgccgcgac
tgggacctggtcgtcgtcggcggcggcgccaccgggctgggcgtggcgctggacgccgcg
gcacgcggcttctcggtcgcgctcgtcgagtcgcacgacttcgcccagggcacctcgtcg
cgcgcgaccaagctcgtgcacggcggcgtgcgctacctggcgcaaggcaacgtgcacctg
gtgcgcgaggcgctgcacgaacgcgcggcgatgctggccaacgcgccgcacgtcgcccag
ccgctgcctttcgtgatgccgggctaccactggtgggagcgcggcttctacggcaccggg
ctcaagctctacgacgcgctggccggcgcgcgcggcctgggcgccaccgaatggctgggc
agcgcccgggtgcaggcgctgctgcccggcgtgcagccgcgcgggctgtggggcggcgtc
aagtactgggacggccaattcgacgacgcgcgttacgccgtgctgctggcgcgcaccgcc
gccgcgcgcggcgcggtcgtgctgaaccactgcgccgccaccgcgctgctgcgccgcgac
ggccgcgtgcacggcgtcgtcgtgcgcgacgccgagaccggcgccgaggcgacgctgtcg
gcgcgctgcgtagtcaacgccgccggcgtctgggtcgacaccttgcgcgacctggaccgc
gacgaccaggccccggcgcgtgccccgctggtcgcgcccagccagggcgtgcacctggtc
gtcgaccgccgtttcctgcccggcacgcacgcgctgctggtgcccaagaccgccgacggg
cgggtgctcttcgccgtgccctggctgggcaagaccatcctcggcacgaccgacacgccg
cgcgaggacctggcgcgtgaaccgcagcccttcccggccgaggtcgacttcatcctgcgc
gagagcgcgcgctacctgcagcaggcgccgcggcgcgaagacgtgcgctcggtctgggtc
ggcctgcgcccgctggtgcgccacgacggcgaggccggcgacaccaaggcgctgtcgcgc
gagcacacggtgctggtcgccgccagcggcctggtcaccgtcaccggcggcaagtggacg
acttaccgcgcgatggccgaggacgtgctggaccgctgcatggcccagggcctgctgccg
cgccggccggccggcgcgacggcgcggctgcagctcgtcggcgcggcaccggggcgctcg
ctggcggcgccgccgggcgaacatctctacggcagcgaagccgcgacgctgcgcgccctg
cccggtgcggagcgctggctctggcgcgacggcgacggcggcctcagcgaggcgatggtg
cgtttcgccgcccgccacgaagcggcgcgcacggtcgaggacgtgctggcgcggcgctcg
cggctgctgttcctggacgccgccgaggccggccggctggccggcgcggtggcggcgatc
ctcggcgacgagctggagcgtgagctcgacccggcgccgttcgaggcgctggccgcacgc
tacacgcggctgccctga

DBGET integrated database retrieval system