KEGG   Rubrivivax gelatinosus: RGE_15960Help
Entry
RGE_15960         CDS       T01803                                 

Gene name
gcvT
Definition
(GenBank) aminomethyltransferase
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
rge  Rubrivivax gelatinosus
Pathway
rge00260  Glycine, serine and threonine metabolism
rge00630  Glyoxylate and dicarboxylate metabolism
rge00670  One carbon pool by folate
rge01100  Metabolic pathways
rge01110  Biosynthesis of secondary metabolites
rge01130  Biosynthesis of antibiotics
rge01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RGE_15960 (gcvT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RGE_15960 (gcvT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    RGE_15960 (gcvT)
Enzymes [BR:rge01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     RGE_15960 (gcvT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C
Motif
Other DBs
NCBI-ProteinID: BAL94937
UniProt: I0HPK0
LinkDB All DBs
Position
complement(1643624..1644751)
Genome map
AA seq 375 aa AA seqDB search
MTELLKTPLHALHLSLGARMVPFAGYAMPVQYRDGLIAEHRQCRSAAALFDVSHMGQVRL
SGADAAAALETLVPVDVVDLAVGRQRYAFFTNEHGGLLDDLMISRPAPGTGFGDLFLVVN
AGCKDADLRHLQTNIGHRCTVVGMPERALLALQGPQAADALARLNPGVKDLVFMTGGVFE
LADAPCFVTRSGYTGEDGFEISVPAERAEALASALLALPEVKPAGLGARDTLRLEAGLCL
YGHDIDENTSPVEAGLTWAIQKVRRPGGAREGGYPGAAAVERHLAGGAMRKRVGLVGLER
VPVREGTAIVDAHGHALGRVTSGTLAPGVDRPIAMAYLPQDHAAPEHEVYAEVRGKRLPM
RVTKMPFQPHRYHRG
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgagcttctgaagacgcccctgcatgcgctgcacctgagcctgggtgcgcgcatg
gtcccgttcgccggctacgcgatgccggtgcagtaccgcgacggcctgatcgccgaacac
cgccagtgccgcagcgccgcggcgctgttcgacgtctcgcacatgggccaggtgcggctg
tcgggcgccgacgccgcggccgcgctggagacgctggtgccggtggatgtcgtcgacctc
gcggtcggccgtcagcgctacgccttcttcaccaacgagcacggcggcctgctcgacgac
ctgatgatctcgcgccccgcgccgggcaccggcttcggcgacctgttcctcgtcgtcaac
gccggctgcaaggacgccgacctgcgccacctgcagacgaacatcggccaccgctgcacc
gtcgtcggcatgcccgaacgcgcgctgctggcgctgcagggcccgcaggccgccgacgcg
ctggcgcggctgaacccgggcgtgaaggacctcgtgttcatgaccggcggcgtcttcgag
ctcgccgacgcgccctgcttcgtcacgcgctcgggctacaccggcgaagacggcttcgag
atctcggtgccggccgaacgtgccgaggcgctggcctcggcgctgctggcgctgccggag
gtcaagcccgccggcctgggcgcacgcgacacgctgcgcctggaagccgggctgtgcctg
tacggccacgacatcgacgagaacacctcgccggtcgaagccggcctcacctgggcgatc
cagaaggtgcgccgccccggcggcgcgcgcgaaggcggctaccccggcgcggcggccgtc
gagcgccacctggcgggcggcgcgatgcgcaagcgtgtcggcctcgtcggcctggaacgt
gtgccggtgcgcgaaggcacggcgatcgtcgacgcccacggccacgcgctgggccgcgtg
accagcggtacgctggcgcccggggtcgaccgtccgatcgcgatggcctatctgccgcag
gaccatgccgcccccgaacacgaggtctacgccgaggtgcgaggcaaacgcctgccgatg
cgcgtgaccaagatgccgttccaaccccaccgctaccaccgcggttga

DBGET integrated database retrieval system