KEGG   Rubrivivax gelatinosus: RGE_16060Help
Entry
RGE_16060         CDS       T01803                                 

Definition
(GenBank) glutathione S transferase domain containing protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rge  Rubrivivax gelatinosus
Pathway
rge00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rge00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    RGE_16060
Enzymes [BR:rge01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     RGE_16060
Transporters [BR:rge02000]
 Other Transporters
  Pores ion channels [TC:1]
   RGE_16060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: BAL94947
UniProt: I0HPL0
LinkDB All DBs
Position
complement(1655000..1655674)
Genome map
AA seq 224 aa AA seqDB search
MIVVHHLENSRSQRVLWLLEELGLAYEVKRYERDRETMLAPPELKRVHPLGKSPVIVDGA
VTVAETGAIVEYLLDTYDPDGRLRPPPATEARRRFTYWLHFAEGSAMPPLLMKLVFDRVR
SAPVPFFIKPVVKGIADKVTGSFIAPNIAAQLAFMEAELSARPWFAGEAFSAADVMMSFP
LEAAAARAGLDARYPKLQDWLKRVHTRAAYGRALERGGPYSIIG
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtcgtccaccacctggagaactcgcgctcgcagcgtgtgctgtggctgctcgag
gaactgggcctggcttacgaagtgaagcgctacgagcgcgaccgcgagacgatgctcgcg
ccgcccgaactgaagcgtgtgcacccgctgggcaagtcgccggtgatcgtcgacggcgcg
gtgacggtggccgagaccggcgccatcgtcgaatacctgctcgacacctacgaccccgac
ggccgcctgcgcccgccgccagccaccgaggcgcgccggcgcttcacctactggctgcac
ttcgccgaaggcagcgcgatgccgccgctgctgatgaagctcgtcttcgaccgcgtgcgc
agcgcgccggtgccgttcttcatcaagcccgtcgtcaagggcatcgccgacaaggtgacg
ggcagcttcatcgccccgaacatcgccgcgcagctggctttcatggaagccgaactgagc
gcccgcccctggttcgccggcgaggccttcagcgccgccgacgtgatgatgagcttcccg
ctcgaagccgcggcggcccgcgccgggctggatgcccgctacccgaagctgcaggactgg
ctgaagcgcgtgcacacgcgcgccgcctacggccgcgcgctggagcgcggcgggccgtat
tcgatcatcggctga

DBGET integrated database retrieval system