KEGG   Rubrivivax gelatinosus: RGE_25890
Entry
RGE_25890         CDS       T01803                                 

Gene name
icmF
Definition
(GenBank) type VI secretion protein IcmF
  KO
K11891  type VI secretion system protein ImpL
Organism
rge  Rubrivivax gelatinosus
Pathway
rge03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:rge00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    RGE_25890 (icmF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rge02044]
    RGE_25890 (icmF)
Secretion system [BR:rge02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   RGE_25890 (icmF)
SSDB
Motif
Pfam: IcmF-related IcmF-related_N IcmF_C Wzy_C
Other DBs
NCBI-ProteinID: BAL95928
UniProt: I0HSE1
LinkDB
Position
complement(2726443..2730252)
AA seq 1269 aa
MNRIWTFLLNPRVLGVIGLAALAAFLFLGANTLQLALVWAGIALGVLLAVGLSVWGVRKL
RARRAARALEQAIEVPGEAEKQVPRADVSALRARLVDAVKTIQKSKLGQLSGSAALYELP
WYMVIGNPAAGKSTAIVKSGLKFPFADGGDAVVQGIGGTRNCDWFFTSEGILLDTAGRYA
VHEEDRQEWLGFLGLLKRHRPKAPINGILIAASLAELGSGRPEAAIQLAKNLRQRVQELT
ETLEVIAPVYLVFTKADLIAGFAEFFEDRDRSERERVWGATLPYAQAQRGDAVAAFDRHF
DELYDGLKQMTLARMAMERGKALPPGVLTFPLEFAERKTALRAFVATLFEENPYQYQPVF
RGFYFTSSVQEGSSASKASERVAQQFALEPRADRLSGLVVAENGFFLKDLFSKVIFADKG
LVQQHASRTKQRLRLATFSAALLLLALATGGWTWSYVGNRQLMANVRADLDHAVRLQAEN
PDLGSRMQALETLQDRIEQLQRYRQDRPLGISLGLYQGEEIEAKLRQEYFAGIRQVMLEP
AAAAIEAYLAEVSANPGRLKPLGKPPESAAATAAAPSTAGRYVDASVEDAGDAYNALKTY
LMLADRERIEPVHLAEQITRFWRGWLDSNRGSMPRERLMQSAERMISFTAGLSRDPAFPT
VANKLALVDQMRELLREQRRGVKGVERVYADIKTRASTRYPPMTVARLIADGDKDVIAGS
HAIPGTFTREAWEGYIAKAFKDAATQELQSTDWVLNIAARDDLTLEGSPEQIQKQLTELY
KTEYVREWQRFMQGISIAEFGSFDEAVKRMNRLGDPADSPIRILLTTLFDQTSWDNPSLL
NERLGKAQKGFVDWIRQTILRQAPQRVEVKVDVTGANAGVPMGPIGREFAALSRIMMSRD
STPPPIKAYLESLSKVRTRFNQIKNQGDPGPGSRALLAATLEGPGSELAEALKLVDEQLL
LGMTDSAKATLRPLLVRPLIQALAVVVPPAETELNRFWAAQVSEPFQRTLASKYPFDTRS
TVEAAPQDIAKIFGPDGAIAKFSNEALGPLVVRRGDAIEPRQWAEIGVRLRPEFTTGFGN
WVAQLDAASGGGGAVTTAGSSGAVTVAADQTLFQILPQGAPGFVEYTVTIDGQSLRYRNA
AAQWTDMVWPNRAGVAGARLSGVTHDGKTVEFVNEPGSAGLGKFMELAQKKRLDGGVNEL
KWTQGPYSVTVHLRVLRQPGESPPTSSRAGAAPGAAPIGTSRLQGLKLPALVAGVEASAA
AASSPKASP
NT seq 3810 nt   +upstreamnt  +downstreamnt
atgaaccgaatctggaccttcctgctcaatccgcgagtgctcggcgtgatcggtcttgcg
gcgctggcagcattcctgttcctcggcgccaacacgttgcagctcgcgctggtctgggcc
ggcatcgcgctcggcgtgctccttgccgtcgggctctcggtgtggggcgtccgcaagctg
cgcgctcgacgggccgcacgagcgctggaacaggcaatcgaagttccgggcgaggccgag
aaacaggttccgcgcgccgacgtgtctgcgctgcgcgcgcgcctggtggacgcggtcaag
accatccaaaagagcaaactcggccagctctccggcagcgccgcgttgtacgagctgccc
tggtacatggtgatcggcaacccggccgcaggcaagagcacggccatcgtcaagagcggg
ctcaagttcccgttcgccgatggcggcgatgcggtagtccagggcatcggcggcacgcgc
aactgcgactggttcttcaccagcgaaggcatcctgctcgacaccgccggccgctacgcc
gtgcacgaggaggaccgccaggagtggctgggttttctggggctgctcaagcgccaccgg
ccgaaggcaccgatcaacggcatcctcatcgctgcgagcctggccgaactaggcagcgga
cggcccgaggccgccatccagctggcgaagaacctgcgccagcgcgtgcaggagctcacc
gagacgctggaagtcatcgcgccggtgtatctggtcttcaccaaggccgacctgatcgcc
ggctttgccgagttcttcgaagaccgcgaccgcagcgagcgcgagcgcgtgtggggcgcc
accctgccctatgcccaggcgcagcgcggtgacgcggtggccgcgttcgaccgccacttc
gacgaactctacgatggcctgaagcagatgacgctggcgcgcatggcgatggagcgcggg
aaggcgctgccccccggcgtgctgaccttcccgctggagttcgccgagcgcaagacggcg
ctgcgcgccttcgtggccacactgttcgaagagaacccgtaccagtaccagccggtgttc
cggggcttctacttcacgagcagcgtgcaggagggaagctcggcgagcaaggctagcgag
cgggtggcacagcagttcgcgctcgagccgcgtgccgatcgcctctcgggcctcgtcgtc
gccgagaacgggttcttcctgaaggacctgttcagcaaggtcatcttcgccgacaagggc
ttggtgcagcagcacgccagccgcacaaagcagcggctgcggctggcgaccttctcggcg
gcgctgctgctgctggcgctggcaaccggcggctggacatggtcgtacgtgggcaaccgg
cagctgatggccaatgtgcgcgccgatctcgaccatgccgtacgcctgcaggccgagaac
cccgacctcggatcgcgcatgcaggcgctggagacactgcaagaccgcatagagcaactg
cagcgctaccgccaagacaggccgctgggcatcagcctcggcctgtaccagggcgaggag
atcgaggccaagctgcgccaagagtacttcgccggcatccggcaggtgatgctggagccg
gcggcggcggcgatcgaggcctatctcgcggaggtcagcgcaaaccccggccgcctgaag
ccgctgggcaagccacccgagtccgccgcggcgacggcagccgcgccgagcaccgccggc
cgctacgtcgatgcatcggtcgaggatgcgggcgatgcctacaacgcgctcaagacttac
ttgatgctcgccgaccgcgaacgcatcgagccggtgcatctggccgagcagatcacccgg
ttctggcgcggctggctcgacagcaaccgcggcagcatgccgcgcgagcgcctgatgcag
agcgccgagcgcatgatcagcttcactgccgggctcagccgcgaccccgccttcccgacc
gtcgccaacaagctcgctctggtcgaccagatgcgcgagctgctgcgcgaacagcgtcgc
ggggtgaagggggttgagcgcgtgtacgcggacatcaagacccgcgcgtccacccgctac
ccgccgatgaccgtcgcgcggctgatcgccgatggcgacaaggacgtcatcgctggcagc
catgcaatccccggcaccttcacccgcgaggcctgggaggggtacatcgccaaggccttc
aaggatgcggccacgcaggagttgcagagcaccgactgggtgctgaacatcgccgcccgc
gacgacctcacgctcgaaggcagcccggagcagatccagaagcagctgaccgagctgtac
aagaccgagtacgtgcgcgagtggcagcgcttcatgcagggcatctcgatcgccgagttc
ggcagcttcgacgaggcggtcaagcgcatgaaccggctgggcgacccggcggactcgccg
atccgtatcctgctgacgacgctgttcgaccagacatcctgggacaacccgtcgctgctg
aacgagcgcctgggcaaggcgcagaagggcttcgtcgactggatccgccagaccatcctg
cggcaggcgccgcagcgcgtggaagtgaaggtcgacgtgaccggcgccaatgccggcgta
ccgatggggcccatcgggcgcgagttcgcggcgctgtcgcgcatcatgatgtcgcgcgac
agcacgccgccgccgatcaaggcgtacctggagagcctgtcgaaggtccgcacgcgcttc
aaccagatcaagaaccagggcgatcccggccccggctcgcgcgcgctgctggccgccacg
ctcgaaggccccggctccgagctggccgaggcgctgaagctggtcgacgagcagttgctg
ctgggcatgaccgacagcgctaaggccacgctgcggccgctgctggtgcgcccgctgatc
caggcgctggcggtggtggtgccaccggccgagaccgagctcaaccgcttctgggccgca
caggtctccgaacccttccagcgcacgctcgcatcgaagtacccgttcgacacccgctcg
accgtggaggctgcgccgcaggacatcgccaagatcttcggccctgacggcgcgatcgcg
aagttctccaacgaggcgctagggccgttggtggtacgccgcggcgacgccatcgagccg
cgccagtgggccgagatcggcgtgcggctgcgtccggagttcaccaccggcttcggcaac
tgggtcgcgcaactcgacgccgccagcggcggcggcggcgcagtcaccacggccggcagc
agcggggcggtgacggtggcggcggaccagacgctgttccagatcctgccgcagggtgcg
cccggcttcgtcgagtacacggtgaccatcgacggccagtcgctgcgctaccgcaatgcc
gccgcgcagtggaccgacatggtctggcccaaccgtgccggcgtggcaggcgcgcggctc
agcggcgtcacccacgatggcaagaccgtcgagttcgtcaacgagcctggcagtgccggg
ctcgggaagttcatggagctggcgcagaagaagaggctggacggcggcgtcaacgaactg
aagtggacgcaggggccttactccgtcacggtgcatttgcgggtgctgcgccagcccggg
gaatcgccaccgaccagcagccgtgccggcgccgcgccaggcgcggcgccgatcggcacc
agccggctgcaagggctcaaactgccggcgctggtggcaggggtcgaagcgagcgcagcg
gcggcgtcctcgccgaaggcatcgccatga

DBGET integrated database retrieval system