KEGG   Rubrivivax gelatinosus: RGE_28280Help
Entry
RGE_28280         CDS       T01803                                 

Gene name
fabI
Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase, FabI
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
rge  Rubrivivax gelatinosus
Pathway
rge00061  Fatty acid biosynthesis
rge00780  Biotin metabolism
rge01100  Metabolic pathways
rge01130  Biosynthesis of antibiotics
rge01212  Fatty acid metabolism
Module
rge_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:rge00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    RGE_28280 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    RGE_28280 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    RGE_28280 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rge01004]
    RGE_28280 (fabI)
Enzymes [BR:rge01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     RGE_28280 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     RGE_28280 (fabI)
Lipid biosynthesis proteins [BR:rge01004]
 Fatty acid synthase
  Component type
   RGE_28280 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR ABC1
Motif
Other DBs
NCBI-ProteinID: BAL96167
UniProt: I0HT30
LinkDB All DBs
Position
3001967..3002749
Genome map
AA seq 260 aa AA seqDB search
MGFLAGKRLLITGLLSNRSIAYGVARACRAQGAELAFSYVGERFRDRITEFAREFDSELV
FECDVGDDAQIETMFKQLAEHWPQFDGFVHSIGYAPREAIGGDFLDGLSREAFRIAHDIS
AYSFPALAKAALPMLKPDAALLTMSYLGAVRAVPNYNTMGLAKASLEASVRYLAASLGPR
GIRVNGISAGPIKTLAASGVKDFGKLLGLVAGSAPLGRNVTIEEVGNVAAFLLSNLASGV
TAEITYVDGGFSQAMVRGEE
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgggttttcttgccggcaagcgcctgctcatcaccggcctgctctccaatcgctcgatc
gcctacggcgtggcccgcgcctgccgtgcgcaaggcgcggagctcgcgttcagctatgtc
ggcgagcgcttccgcgaccgcatcaccgagttcgcccgcgagttcgattcggaactggtg
ttcgaatgcgacgtcggcgacgacgcccagatcgaaacgatgttcaagcagttggccgag
cactggccgcagttcgacggcttcgtgcattcgatcggctacgcgccgcgcgaggcgatc
ggcggcgacttcctcgacggcctgtcgcgcgaagccttccgcatcgcccacgacatctcg
gcctacagcttcccggccctggccaaggcggcgctgccgatgctcaagcccgatgcggcg
ctgctgacgatgagctacctgggcgcggtgcgcgcggtgccgaactacaacacgatgggc
ctggccaaggcctcgctcgaagccagcgtgcgctacctcgcggccagcctcggcccgcgc
ggcatccgcgtcaacggcatctccgccggcccgatcaagacgctggccgccagcggcgtg
aaggacttcggcaagctgctgggcctggtggccggcagcgcgccgctgggccgcaacgtg
accatcgaggaagtcggcaacgtcgccgccttcctgctgtcgaacctggcctccggcgtc
accgccgagatcacctacgtcgacggcggcttcagccaggcgatggtgcgcggcgaggag
tga

DBGET integrated database retrieval system