KEGG   Rubrivivax gelatinosus: RGE_31290Help
Entry
RGE_31290         CDS       T01803                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F AhpF
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
rge  Rubrivivax gelatinosus
Brite
KEGG Orthology (KO) [BR:rge00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    RGE_31290 (ahpF)
Enzymes [BR:rge01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     RGE_31290 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like FAD_oxidored FAD_binding_3 Glutaredoxin DAO FAD_binding_2 K_oxygenase Thi4 AlaDh_PNT_C NAD_binding_8 FMO-like
Motif
Other DBs
NCBI-ProteinID: BAL96468
UniProt: I0HTY1
LinkDB All DBs
Position
3336350..3337918
Genome map
AA seq 522 aa AA seqDB search
MLDANLKNQLKAYLERLQQPIELVASLDDRPASAEMRALLEDIAPLSALISVRYDGSDTR
RPSFSISRAGADMGVRFAAIPMGHEFTSLVLALLQAGGHPPKLDADTIAQIQGLEGDFVF
ETYMSLTCHNCPDVVQALNLMAVLNPRVRHVAIDGGLFKAEVDARQIMAVPTVFLNGQPF
GSGRMEIGEILAKVDTGAAARDAAKLAKKEPYEVLIVGGGPAGAAAAIYAARKGIRTGIV
AERFGGQTLDTLAIENFVSVMETEGPKFAAALEAHVRAYAVDVNVGQQVAAVIPAPQPGA
YATVKLVNGAELKGRTVILATGARWRNVNVPGEQEYKTKGVAYCPHCDGPLFKGKKVAVI
GGGNSGVEAAIDLAGVVEHVTLIEFLDQLKADAVLVNKLKSLPNVTIHTNAQTTEITGDG
QKVNGLRYKDRVSGAEQHVELAGVFVQIGLVPNTEFLKGTLELSRFGEIVIDPKCATSVP
GIFAAGDVTTVPYKQIIIATGEGAKAALSAFDYLIRTPAVQA
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccaacctcaagaaccagctcaaggcctatctcgagcgcctgcagcagccg
atcgaactggtcgcctcgctcgacgaccgcccggcctcggccgagatgcgtgcgctgctc
gaggacatcgcgccgctgtcggcgctgatcagcgtgcgctacgacggttcggacacgcgt
cggccctcgttctcgatcagccgcgccggtgccgacatgggtgtgcgtttcgcggccatc
ccgatgggccacgagttcacctcgctggtgctggcgctgctgcaggccggcggccacccg
cccaagctcgacgccgacacgatcgcgcagatccagggcctcgaaggcgacttcgtcttc
gagacctacatgtcgctgacctgccacaactgccccgacgtcgtgcaggcgctgaacctg
atggcggtgctgaacccgcgcgttcgccacgtcgcgatcgacggcggcctgttcaaggcc
gaggtcgacgcgcgccagatcatggccgtgccgaccgtgttcctgaacggccagcccttc
ggctcgggccgcatggagatcggcgagatcctggccaaggtcgacaccggcgcggccgcg
cgcgacgccgccaagctggcgaagaaggagccgtacgaggtgctgatcgtcggcggcggc
ccggccggcgccgcggcggcgatctacgccgcgcgcaagggcatccgcaccggcatcgtc
gccgagcgtttcggcggccagacgctggacacgctggccatcgagaacttcgtctcggtg
atggagaccgaagggccgaagttcgccgccgcgctggaggcccacgtgcgcgcctacgcc
gtcgacgtcaacgtcggccagcaggtcgcggccgtgatcccggcgccgcagccgggcgcc
tacgcgaccgtcaagctggtcaacggcgccgagctcaagggccgcacggtcatcctggcc
accggcgcacgctggcgcaacgtcaacgtgcccggcgagcaggagtacaagaccaagggc
gtggcctactgcccgcactgcgacggcccgctgttcaagggcaagaaggtcgccgtcatc
ggcggcggcaactccggcgtcgaggccgcgatcgacctggccggcgtcgtcgagcacgtg
acgctgatcgagttcctcgaccagctgaaggccgacgcggtgctggtcaacaagctgaag
agcctgcccaacgtcacgatccacaccaacgcgcagacgaccgagatcaccggcgacggc
cagaaggtcaacggcctgcgctacaaggatcgcgtctcgggcgccgagcagcacgtcgag
ctggccggcgtcttcgtgcagatcggcctggtgcccaacaccgagttcctgaagggcacg
ctggagctgagccgcttcggcgagatcgtcatcgacccgaagtgcgcgaccagcgtgccg
ggcatcttcgccgccggcgacgtgacgaccgtgccgtacaagcagatcatcatcgccacc
ggcgaaggcgcgaaggcggcactgtcggccttcgactacctgatccgcacgccggccgtc
caggcctga

DBGET integrated database retrieval system