KEGG   Rubrivivax gelatinosus: RGE_33490Help
Entry
RGE_33490         CDS       T01803                                 

Gene name
bchL
Definition
(GenBank) light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein
  KO
K04037  light-independent protochlorophyllide reductase subunit L [EC:1.3.7.7]
Organism
rge  Rubrivivax gelatinosus
Pathway
rge00860  Porphyrin and chlorophyll metabolism
rge01100  Metabolic pathways
rge01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rge00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RGE_33490 (bchL)
Enzymes [BR:rge01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     RGE_33490 (bchL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_NifH CbiA AAA_31 ArsA_ATPase ParA MeaB AAA_24 AAA_26 MipZ AAA_10 SRP54 AAA_25 CBP_BcsQ NB-ARC
Motif
Other DBs
NCBI-ProteinID: BAL96688
UniProt: Q9JPA5
LinkDB All DBs
Position
3579360..3580268
Genome map
AA seq 302 aa AA seqDB search
MSTATISPSQIGRGARPDGEGSVQVQMETGAKIGNAKVFAIYGKGGIGKSTTSSNLSVAF
SKLGKRVLQIGCDPKHDSTFTLTKRMVPTVIDVLETVNFHPEELRVEDFVFEGTNGVMCV
EAGGPPAGTGCGGYVVGQTVKLLKEHHLLEETDVVVFDVLGDVVCGGFAAPLQHADRALI
VTANDFDSIFAANRIVQAIGAKAKNYNVRLGGIIANRSDATDQIDKFNERIGMRSLARIP
ALDVIRKSRLKKATLFEMEESPEVLAVQAEYLQLAQRLWDGVDPLYCEPLKDRDIFDLLG
YD
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgagcacggccacgatctcccccagccagatcggccgcggcgcacgcccggacggcgaa
ggcagcgttcaggtgcagatggaaaccggagccaagatcggcaacgccaaggtgttcgcg
atctacggcaagggcggcatcggcaaaagcacgacgtcgagcaacctgtcggtggccttc
agcaagctcggcaagcgcgtgctgcagatcggctgcgaccctaagcacgactccaccttc
acgctgaccaagcgcatggtgcccaccgtcatcgacgtgctcgagacggtgaacttccac
cccgaggaactgcgtgtcgaggacttcgtcttcgaaggcaccaacggcgtgatgtgtgtc
gaggccggcggcccgcccgcgggcaccggctgcggcggctacgtcgtcggccagaccgtc
aagctgctcaaggagcaccacctgctcgaggaaaccgacgtcgtcgtcttcgacgtgctc
ggcgacgtggtctgcggcggtttcgccgccccgctgcagcacgccgaccgcgcgctgatc
gtcaccgccaacgacttcgactcgatcttcgccgccaaccgcatcgtccaggcgatcggc
gccaaggcgaagaactacaacgtgcgcctgggcggcatcatcgccaaccgctccgacgcc
accgaccagatcgacaagttcaacgagcgcatcggcatgcgctcgctggcgcgcatcccg
gcgctggacgtcatccgcaagagccggctgaagaaggccacgctgttcgagatggaagaa
agccccgaggtgctggcggtgcaggccgagtacctgcagctcgcccagcgcctgtgggac
ggcgtcgacccgctgtactgcgagccgctgaaggatcgcgacatcttcgacctgctgggc
tacgactga

DBGET integrated database retrieval system