KEGG   Rubrivivax gelatinosus: RGE_36050Help
Entry
RGE_36050         CDS       T01803                                 

Gene name
cbbS
Definition
(GenBank) ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit CbbS
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
rge  Rubrivivax gelatinosus
Pathway
rge00630  Glyoxylate and dicarboxylate metabolism
rge00710  Carbon fixation in photosynthetic organisms
rge01100  Metabolic pathways
rge01120  Microbial metabolism in diverse environments
rge01200  Carbon metabolism
Module
rge_M00165  Reductive pentose phosphate cycle (Calvin cycle)
rge_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
rge_M00612  Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:rge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RGE_36050 (cbbS)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    RGE_36050 (cbbS)
Enzymes [BR:rge01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     RGE_36050 (cbbS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: BAL96944
UniProt: I0HVA7
LinkDB All DBs
Position
complement(3845802..3846236)
Genome map
AA seq 144 aa AA seqDB search
MMTNPTGRLTQGQFSFLPDLTDEEITLQIEYGLKKGYAWSIEYTDDPHPRNTYWEMYGMP
MFDLQDAAGVLMELNACRKTFPNHYIRLMAFDSTRGIESIAMSFLVNRPPTEPGFGVVRQ
EVNGRSMRYTVHSYATDKPEAQRY
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccaaccccaccggccggctcacgcaaggccagttcagcttcctcccggacctg
accgacgaggagatcacgctgcagatcgagtacggcctgaagaagggctacgcctggagc
atcgaatacaccgatgacccgcacccgcgcaatacgtactgggagatgtacggcatgccg
atgttcgacctgcaggacgccgccggcgtgctgatggagctgaacgcctgccgcaagacc
ttccccaaccactacatccgcctgatggccttcgattcgacccggggcatcgagtcgatc
gcgatgagcttcctcgtcaaccggccgccgaccgagcccggcttcggcgtcgtgcgccag
gaggtcaacggccgctcgatgcgctacacggtccacagctacgcgaccgacaagccggaa
gcgcaacgctactga

DBGET integrated database retrieval system