KEGG   Rubrivivax gelatinosus: RGE_45350Help
Entry
RGE_45350         CDS       T01803                                 

Definition
(GenBank) enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
rge  Rubrivivax gelatinosus
Pathway
rge00071  Fatty acid degradation
rge00280  Valine, leucine and isoleucine degradation
rge00281  Geraniol degradation
rge00310  Lysine degradation
rge00360  Phenylalanine metabolism
rge00362  Benzoate degradation
rge00380  Tryptophan metabolism
rge00410  beta-Alanine metabolism
rge00627  Aminobenzoate degradation
rge00640  Propanoate metabolism
rge00650  Butanoate metabolism
rge00903  Limonene and pinene degradation
rge01100  Metabolic pathways
rge01110  Biosynthesis of secondary metabolites
rge01120  Microbial metabolism in diverse environments
rge01130  Biosynthesis of antibiotics
rge01212  Fatty acid metabolism
Module
rge_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    RGE_45350
   00650 Butanoate metabolism
    RGE_45350
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RGE_45350
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RGE_45350
   00310 Lysine degradation
    RGE_45350
   00360 Phenylalanine metabolism
    RGE_45350
   00380 Tryptophan metabolism
    RGE_45350
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RGE_45350
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RGE_45350
   00281 Geraniol degradation
    RGE_45350
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RGE_45350
   00627 Aminobenzoate degradation
    RGE_45350
   00930 Caprolactam degradation
    RGE_45350
Enzymes [BR:rge01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RGE_45350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: BAL97870
UniProt: I0HXY3
LinkDB All DBs
Position
4858137..4858970
Genome map
AA seq 277 aa AA seqDB search
MTTDFFRLELADTGVAHLQLARPERLNTMTPAFFPALREVVESLNAEGRTRVLVISSTGK
HFSAGMALDVFASDLSLLDTGNARRRLAFQDSLRQLMRCFDVLESARFPVIAAVQGGCIG
GALDLAAACDLRVCSADAFFTVQEIQIGMAADLGVLQRLPKIVPPGVARQMAYTGERLGA
ERALAIGLVNAVLPDAAATLDHALTLAAEIATKSPLAVAGSKLALNYAIDHPTADALEQM
ALLQSAIFDIGEMAKAIQAWQTKADAGFDPLAPVPRV
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccgacttcttccgcctcgagctcgccgacaccggcgtcgcccacctgcagctc
gcgcgccccgagcggctgaacacgatgacgccggccttcttcccggcgctgcgcgaggtc
gtcgagtcgctcaacgccgagggccgcacgcgcgtgctggtgatctcctcgaccggcaag
cacttcagcgccggcatggcgctggacgtcttcgccagcgacctgtcgctgctggacacc
ggcaacgcgcgccggcgcctggccttccaggactcgctgcgccagctgatgcgctgtttc
gacgtgctggaatcggcgcgtttcccggtcatcgccgcggttcagggcggctgcatcggc
ggcgcgctcgacctggcggcggcctgcgacctgcgtgtctgctctgccgacgccttcttc
accgtgcaggagatccagatcggcatggccgccgacctgggcgtgctgcagcgcctgccg
aagatcgtgccgccgggcgtcgcccgccagatggcctacaccggcgaacggctgggtgcc
gagcgcgcgctggccatcggcctggtcaacgccgtgctgcccgacgccgcggcgacgctg
gaccacgcgctgacgctggccgccgagatcgccaccaagtcgccgctggccgtcgccggc
agcaagctggcgctgaactacgccatcgaccacccgacggccgacgcgctggagcagatg
gcgctgctgcagagcgcgatcttcgacatcggcgagatggccaaggcgatccaggcctgg
cagaccaaggccgacgccggcttcgacccgctggcgcccgtcccgcgcgtctag

DBGET integrated database retrieval system