KEGG   Rubrivivax gelatinosus: RGE_46510Help
Entry
RGE_46510         CDS       T01803                                 

Definition
(GenBank) putative serine/threonine protein kinase
Organism
rge  Rubrivivax gelatinosus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo
Motif
Other DBs
NCBI-ProteinID: BAL97984
UniProt: I0HY97
LinkDB All DBs
Position
complement(4983675..4984553)
Genome map
AA seq 292 aa AA seqDB search
MRPETPAVGPVVGGYRLASRLGSGEHGEVFVATRLASGEQVAFKRLRATIADSRRRAEAA
RRFAAEAETTRRLQHPDIVRVLDAGHDDAGPWLVMELLPGCSLERYTHAARLLPEPVVIG
VMARVARALAYAHGRGVVHRDLKPSNVIVDWSSRRVTLTDFGLARRADGDSTRTGLVLGS
PAYLAPEQLAGAPATPRGDLYALGVTLFELLAGRRPHESPSLGELLRQVAEQPAPDLARL
RPGLPPALTGIVARLLAKPPAQRPASADEVAKALEDVLQTIDAAAAGPMSRP
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
gtgcgccccgagacccctgccgtcggccccgtcgtgggcggataccgcctcgccagccgt
ctgggctcgggcgagcacggcgaggttttcgtcgccacccgactggccagcggcgagcag
gtcgccttcaagcggctgcgcgcgacgatcgccgattcgcgccggcgcgccgaggcggcg
cgccgcttcgccgccgaggccgagacgacgcggcggctgcagcaccccgacatcgtgcgt
gtgctcgacgccggccacgacgacgccggcccctggctggtgatggagctgctgcccggc
tgcagcctggagcgctacacccacgcggcgcgcctgttgcccgagccggtggtgatcggc
gtgatggcccgggtcgcgcgtgcgctggcctacgcccacgggcgcggcgtcgtgcaccgc
gatctcaagccgtccaacgtcatcgtcgactggagcagccgccgcgtcacgctgaccgac
ttcggcctcgcccgccgcgccgacggcgacagcacgcgtaccgggctcgtgctcggctcg
ccggcctacctggcgcccgagcagctcgccggggcgccggccacgccgcgcggcgacctg
tacgcgctgggtgtcaccctgttcgagctgctggccggccgccggccgcacgagtcgccg
tcgctgggcgaactgctgcgccaggtggccgagcagccggcgccggacctcgcccgcctg
cgccccggcctgccgccggcgctgaccggcatcgtcgcgcgcctgctcgccaaaccgccg
gcgcagcgtccggcttcggccgacgaggtggccaaggcgctggaggacgtcctccagacg
atcgacgcggccgcggcaggaccgatgtcacgcccttga

DBGET integrated database retrieval system