KEGG   Roseomonas gilardii: RGI145_09310Help
Entry
RGI145_09310      CDS       T04615                                 

Definition
(GenBank) transglutaminase
Organism
rgi  Roseomonas gilardii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bact_transglu_N Transglut_core
Motif
Other DBs
NCBI-ProteinID: APT57270
UniProt: A0A1L7AEW6
LinkDB All DBs
Position
1:2068970..2069839
Genome map
AA seq 289 aa AA seqDB search
MILRVRHVTSYAYGHPVEMATHMLCLTPRELPAQRVLSTTLTSTPEAARTTIGRDHFGNH
VTWLFLDSPHERFEVVTEAVVDVHFLPPPPAAATLPWEAVAAMARRDPEAAEFTFPSPMV
RVGEAARDFVTPSFPAGRPVLEGLLDLNSRFKKEFRFRSGVTGIATPVDEVLRRREGVCQ
DFSHVMIAGLRALGLPARYTSGYIRTYPPPGQPRRVGADMSHAWVGAWLGPELGWLNLDP
TNNILLSEEHVLLGWGRDFGDVSPLRGIILGGGRHKLEVGVDLAPVGED
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgatcctgcgtgtccggcacgtcaccagctatgcctatggccatccggtggagatggcc
acgcacatgctctgcctgacgccgcgcgaactgcccgcgcagcgcgtgctaagcacgacg
ctgaccagcacgccggaggccgcccggaccaccatcgggcgggaccacttcggcaaccac
gtcacctggctcttcctcgacagcccgcacgaacgcttcgaggtggtgaccgaggcggtg
gtggacgtgcatttcctgccccctcccccggccgccgcgaccctgccctgggaggcggtg
gcggccatggcgcggcgcgacccggaggcggcggagttcaccttcccgagccccatggtc
cgggtgggcgaggcggcgcgggacttcgtcaccccctccttccccgccggccgcccggtg
ctggaagggctgctggacctgaattcccgcttcaagaaggaattccgcttccgctccggc
gtcaccggcatcgccaccccggtggacgaggtgctgcgccggcgcgagggcgtctgccag
gacttctcccatgtcatgatcgccggcctgcgcgcccttggcctgccggcgcgctacacc
tccggctatatccgcacctatccgccgccggggcagccccgccgcgtcggcgccgacatg
tcgcatgcctgggtcggcgcctggctgggaccggagctcggctggctgaacctggacccg
accaacaacatcctgctctcggaggagcatgtgctgctcggctggggtcgcgatttcggc
gatgtctcgccgctgcgcggcatcatcctgggcggcgggcggcacaagctggaagtgggc
gtggatctcgcgccggtcggcgaggactga

DBGET integrated database retrieval system