KEGG   Roseomonas gilardii: RGI145_13350Help
Entry
RGI145_13350      CDS       T04615                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
rgi  Roseomonas gilardii
Pathway
rgi00473  D-Alanine metabolism
rgi00550  Peptidoglycan biosynthesis
rgi01100  Metabolic pathways
rgi01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rgi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    RGI145_13350
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RGI145_13350
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    RGI145_13350
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rgi01011]
    RGI145_13350
Enzymes [BR:rgi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     RGI145_13350
Peptidoglycan biosynthesis and degradation proteins [BR:rgi01011]
 Precursor biosynthesis
  Amino acid ligase
   RGI145_13350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 B12-binding Peripla_BP_6 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: APT57955
UniProt: A0A1L7AGQ8
LinkDB All DBs
Position
1:2940398..2941348
Genome map
AA seq 316 aa AA seqDB search
MTRVAVLLGGISAEREVSLSSGTQCAAALEKAGHEVTRIEVGQDPAALIQALRDAKPDVV
FNALHGRFGEDGCVQGILDWLGIPYTHSGVRASSLAMNKAAAKAAFTAAGLPVAPHRLIE
AAELEEADPLPTPYVIKPVEEGSSVGVHIIKGGDNRRAEIARSWRYGTIMAEPYIPGREL
TVAVMGDRALEVTEINAEAGEFYDYDSKYADGGSRHTLPAPVPPAIRARALEVALDAHRA
LGCRGVSRSDFRYDDTGEGEGRLVLLEVNTQPGMTPTSLVPEQAAHLGIAFPDLCDWIVS
QARHDGLRPDALRHAA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgcgtcgccgtccttctggggggaatctcggcggagcgggaggtctctctgtcc
tccggcacgcaatgcgccgccgcgctggaaaaggccgggcatgaggtcacccgcatcgag
gtgggccaggaccccgccgcgctgatccaggcgctgcgggacgccaagcccgatgtggtg
ttcaacgccctgcacggccgcttcggcgaggatggctgcgtccagggcatcctggactgg
ctcggcatcccctacacgcattcgggggtgcgcgcctcgtcgctggcgatgaacaaggcc
gccgccaaggccgccttcaccgccgccggcctgcccgtcgcgccgcaccggctgatcgag
gcggcggagctggaggaggccgaccccctccccacgccctatgtcatcaagccggtggag
gaaggctcctcggtcggcgtgcacatcatcaagggcggcgacaaccgccgcgccgagatc
gcccgctcctggcgctacggcaccatcatggccgagccctatatcccggggcgcgagctg
accgtcgcggtgatgggcgaccgggcgctggaagtcaccgagatcaacgccgaggcgggc
gagttctacgactacgattccaaatacgccgatggcggctcccgccacacccttcccgcc
ccggtgccgccggcgatccgcgcccgggcgctggaggtggcgctggacgcccaccgcgcc
ctcggctgccgcggcgtctcgcgctccgacttccgctacgacgacaccggcgagggcgag
ggccggctcgtgctgctggaggtcaacacccagcccggcatgacgcccacctcgctggtg
ccggaacaggcggcgcatctcggcatcgccttccccgatctctgcgactggatcgtctcc
caggcccgccatgacgggctgcgccccgatgcgctacgccatgccgcgtga

DBGET integrated database retrieval system