KEGG   Roseomonas gilardii: RGI145_13775Help
Entry
RGI145_13775      CDS       T04615                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
rgi  Roseomonas gilardii
Brite
KEGG Orthology (KO) [BR:rgi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:rgi03012]
    RGI145_13775
   03029 Mitochondrial biogenesis [BR:rgi03029]
    RGI145_13775
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rgi04147]
    RGI145_13775
Translation factors [BR:rgi03012]
 Eukaryotic Type
  Elongation factors
   RGI145_13775
 Prokaryotic Type
   RGI145_13775
Mitochondrial biogenesis [BR:rgi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    RGI145_13775
Exosome [BR:rgi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   RGI145_13775
  Exosomal proteins of breast cancer cells
   RGI145_13775
  Exosomal proteins of colorectal cancer cells
   RGI145_13775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-ProteinID: APT58030
UniProt: A0A1L7AH42
LinkDB All DBs
Position
1:complement(3019170..3020357)
Genome map
AA seq 395 aa AA seqDB search
MAKAKFERNKPHCNIGTIGHVDHGKTSLTAAITKVLAKSGGASFTAYDQIDKAPEERARG
ITISTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPALVVFLNKMDLADPDLVELVEMEVRELLSSYQFPGDDIPIVKGSAVAALED
KTPEIGEQAILELMAEVDRYIPQPERPKDLPFLMPIEDVFSISGRGTVVTGRVERGIVKV
GEEVEIVGLKDTVKTTVTGVEMFRKLLDSGEAGDNIGALLRGTKREDVERGQVLAKPGSI
TPHTRFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGVVKLPEGVEMVMPGDNVAM
DVELIAPIAMDQGLRFAIREGGRTVGAGVVASIEK
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaggcgaagttcgagcggaacaagccgcactgcaacatcggcacgatcgggcac
gttgaccacggcaagacgtcgctgacggcggcgatcacgaaggtgctggcgaagtctggt
ggagcgtcgttcacggcgtacgaccagatcgacaaggcgccggaggagcgtgcgcgcggg
atcacgatctcgacggcgcatgtggagtacgagacggcgaaccgtcactacgcgcacgtg
gactgccctggccacgccgactacgtgaagaacatgatcacgggtgcggcgcagatggac
ggcgcaatcctggtggtgtcggcggccgatggcccgatgccgcagacgcgcgagcacatc
ctgctggcgcggcaggtgggcgtgccggcgctggtggtgttcctgaacaagatggacctg
gcggatcctgacctggtggagctggtggagatggaggtgcgcgagctgctgtcctcctac
cagttcccgggcgacgacattccgatcgtcaagggctcggcggtggcggcgctggaagac
aagacgcccgagatcggcgagcaggcgatcctggagctgatggcggaagtggaccgctac
atcccgcagccggagcgtccgaaggacctgccgttcctgatgccgatcgaggacgtgttc
tcgatctcggggcgcggcacggtggtgacgggccgcgtggagcggggcatcgtgaaggtg
ggcgaggaagtcgagatcgtgggcctgaaggacacggtcaagacgacggtcacgggtgtg
gagatgttccgcaagctgctggacagcggcgaagcgggggacaacatcggggcgctgctg
cgtggcacgaagcgtgaggacgtggagcgcgggcaggtgctggccaagcccggctcgatc
acgccgcacacgcgcttcaaggccgaggcctatatcctgaccaaggaagagggtggccgg
cacacgccgttcttcacgaactaccgtccgcagttctacttccgcacgaccgacgtgacg
ggcgtggtgaagctgccggaaggcgtggagatggtgatgccgggcgacaacgtggcgatg
gacgtcgagctgatcgcgccgatcgccatggaccagggcctgcgcttcgccatccgcgag
ggcggccgcaccgtcggcgccggcgtcgtcgcctccatcgagaagtga

DBGET integrated database retrieval system