KEGG   Roseomonas gilardii: RGI145_16045Help
Entry
RGI145_16045      CDS       T04615                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
rgi  Roseomonas gilardii
Pathway
rgi00020  Citrate cycle (TCA cycle)
rgi00190  Oxidative phosphorylation
rgi00650  Butanoate metabolism
rgi01100  Metabolic pathways
rgi01110  Biosynthesis of secondary metabolites
rgi01120  Microbial metabolism in diverse environments
rgi01130  Biosynthesis of antibiotics
rgi01200  Carbon metabolism
Module
rgi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rgi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rgi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RGI145_16045
   00650 Butanoate metabolism
    RGI145_16045
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    RGI145_16045
Enzymes [BR:rgi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     RGI145_16045
    1.3.5.4  fumarate reductase (quinol)
     RGI145_16045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4
Motif
Other DBs
NCBI-ProteinID: APT58395
UniProt: A0A1L7AI08
LinkDB All DBs
Position
1:3543040..3544854
Genome map
AA seq 604 aa AA seqDB search
MNAISKPGIGGAAYRVVDHTYDVVVVGAGGAGLRSTFGMGAAGLKTACITKVFPTRSHTV
AAQGGIGAALGNMGEDDWRWHMYDTVKGSDWLGDQDAIEYMCREAVPSIIELEHYGVPFS
RTEDGKIYQRPFGGHMQNYGKTPAMRACAAADRTGHAILHTLYQQSLKHNCEFFVEYFAL
DLIMEEGACRGVMAWCLEDGSIHRFRAQTVVLATGGYGRAWFSCTSAHTCTGDGGGMVLR
AGLPLQDPEFVQFHPTGIYGSGCLVTEGARGEGGYLTNSEGERFMERYAPTAKDLASRDV
VSRAMSMEIREGRGVGPKKDHIHLHLEHLGAELLHERLPGISETAKIFAGVDVTKEPIPM
LPTVHYNMGGIPTNIHCEVLNPTADDQDRVVPGLMAVGEAACVSVHGANRLGTNSLLDLV
VFGRAAAHRAAETVKPGATQAPLPADAGDASLSRLDGVRNAKGGTSVAALRERMQRTMQS
HAAVFRTSDSLKEGVDKMQTVYDGLSDIRIHDRSLVWNSDLMEALELHNLMGNAMCTMVS
AEARHESRGAHAHEDYPERDDVNWLKHTIATCDSNGLVKLDYRDVKMRTLTNEVQVFPPK
PRVY
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgatcagcaagccgggaatcggcggcgcggcctaccgggtggtggaccatacc
tatgacgtcgtggtggtgggggccggcggcgccgggctgcgctccaccttcggcatgggc
gccgcgggcctgaagacggcctgtatcaccaaggtcttccccacccgctcccacaccgtg
gcggcgcagggcggcatcggcgccgcgctgggcaacatgggcgaggacgactggcgctgg
cacatgtacgacaccgtgaaggggtcggactggctcggcgaccaggacgccatcgagtac
atgtgccgcgaggccgtgccctcgatcatcgagctggagcactatggcgtgccgttctcc
cgcaccgaggacggcaagatctaccagcggcccttcggcggccacatgcagaactacggc
aagacccccgcgatgcgcgcctgcgccgcggccgaccgcaccggccatgccatcctgcac
acgctctaccagcagtcgctgaagcacaactgcgagttcttcgtcgaatacttcgccctc
gacctcatcatggaggaaggcgcctgccgcggcgtgatggcttggtgcctggaggacggc
tccatccaccgcttccgtgcccagaccgtggtgctcgccaccggcggctatggccgcgcc
tggttctcctgcacctccgcccacacctgcacgggcgatggcggcggcatggtgctgcgc
gccggcctgccgctgcaggacccggaattcgtgcagttccacccgaccggcatctacggc
tccggctgcctcgtgaccgaaggcgcgcgcggcgagggcggctacctcaccaattccgag
ggcgagcgcttcatggagcgctacgcgccgaccgcgaaggacctcgcctcgcgcgacgtc
gtctcgcgcgccatgtcgatggagatccgcgagggccgcggcgtcggcccgaagaaggac
cacatccacctgcacctggagcatctgggcgccgagctgctgcatgagcgcctgccgggc
atctccgagacggcgaagatcttcgccggcgtggacgtgaccaaggagccgatcccgatg
ctgccgaccgtccactacaacatgggcggcattcccacgaacatccattgcgaggtgctg
aacccgacggcggacgaccaggaccgcgtggtccccggcctgatggcggtgggcgaggcg
gcctgcgtctccgtgcacggcgccaaccgcctcggcaccaactcgctgctcgacctcgtg
gtcttcggccgcgccgccgcgcaccgcgccgccgagacggtcaagccgggcgcgacccag
gcgccgctgccggcggatgcaggcgatgcctcgctctcccgcctcgacggcgtgcgcaac
gccaagggcggcaccagcgtcgccgcgctgcgcgaacgcatgcagcgcacgatgcagagc
cacgcggcggtgttccgcacctccgacagcctgaaggaaggcgtggacaagatgcagacg
gtctatgacggcctgtccgacatccgcatccacgaccgctccctggtctggaacagcgac
ctgatggaggcgctggagctgcacaacctgatgggcaacgccatgtgcaccatggtcagc
gccgaggcgcgccacgagagccgcggcgcccatgcccacgaggactatcccgagcgcgac
gacgtgaactggctgaagcacaccatcgccacctgcgacagcaacggcctcgtcaagctc
gactaccgcgacgtgaagatgcgcaccctcacgaacgaggtccaggtcttcccgcccaag
ccgcgcgtgtactga

DBGET integrated database retrieval system