KEGG   Roseomonas gilardii: RGI145_16165Help
Entry
RGI145_16165      CDS       T04615                                 

Definition
(GenBank) acetylornithine deacetylase
  KO
K01438  acetylornithine deacetylase [EC:3.5.1.16]
Organism
rgi  Roseomonas gilardii
Pathway
rgi00220  Arginine biosynthesis
rgi01100  Metabolic pathways
rgi01110  Biosynthesis of secondary metabolites
rgi01130  Biosynthesis of antibiotics
rgi01210  2-Oxocarboxylic acid metabolism
rgi01230  Biosynthesis of amino acids
Module
rgi_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:rgi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    RGI145_16165
Enzymes [BR:rgi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     RGI145_16165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: APT58413
UniProt: A0A1L7AHY5
LinkDB All DBs
Position
1:3573441..3574733
Genome map
AA seq 430 aa AA seqDB search
MSDPQIDTQIAARIAEMVDRNFDAQIETTKRFSAIPSTRGAEGPAQDMMADLLRERGYTV
DDWAIRMEDLADLPDCGVIEHDFSQARTVVGTLRPAQETGRSLILQGHCDVVPAGPLDMW
ETPPFSPVVKDGWMYGRGAGDMKSGTIAALYAVEAVRQAGYSLKGRLHFQSVIEEESTGV
GALSTLQRGYRADCALLPEPSNRTITDVCVGVLWFRLKVRGIPAHVAYASDGSNAIKAAY
RLIQGLEGLEADWNRRAKSDSHYGSMEHPLNFNPGIIKGGDWASSVPAWCDVDCRIAILP
GWDVDACRKEIIDCVMATAKADPFLGNNPPEVVWSGYLSRGYVLENAEEPVALLRAANAA
FGGGELRSRAGTGLNDARFYSLFYGIPAFCYGPKAEQVHGFNERVEIESIRGTTKSIAAF
VAGWCGVERA
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatccccaaatcgacacccagatcgctgcccgcatcgccgagatggtggaccgg
aacttcgacgcgcagatcgagacgacgaagcgcttctccgccatccccagcacacgcggc
gccgagggcccggcccaggacatgatggccgacctgctgcgcgagcgcggctacacggtc
gatgactgggcgatccggatggaggatctcgccgacctgcccgattgcggcgtgatcgag
cacgacttctcccaggcccggaccgtggtgggcacgctgcgcccggcgcaggaaacggga
cgctcgctgatccttcaggggcattgcgacgtggtgccggcagggccgctggacatgtgg
gaaacgccgcccttcagcccggtggtgaaggatggctggatgtacgggcgcggtgccggc
gacatgaaatccggcaccatcgccgcgctctacgcggtcgaggcggtgcggcaggcgggc
tacagcctcaaggggcggctgcacttccagtcggtgatcgaggaggagagcaccggcgtc
ggcgcgctctcgacattgcagcgcggctaccgcgccgattgcgccctgctgccggagccg
agcaaccggacgatcaccgatgtctgcgtcggcgtgctgtggttccggctgaaggtgcgt
ggcatccccgcgcatgtggcctatgccagcgacggctccaacgcgatcaaggcggcctac
cggctgatccaggggctggaagggttggaggcggactggaaccgccgggcgaagagcgac
tcgcattacggttcgatggagcatccgctgaacttcaacccgggcatcatcaagggcggc
gactgggcctcctccgtgccggcctggtgcgacgtggactgccgcatcgcgatcctgccg
ggctgggacgtcgatgcctgccgcaaggagatcatcgactgtgtgatggccacggcgaag
gccgaccccttcctcggcaacaacccgccggaggtggtctggtcgggctatctctcgcgc
ggctacgtgctggagaatgccgaggagccggtggctctgctgcgcgcggcgaacgcggcc
ttcggcggcggcgagctgcgcagccgcgccggcaccgggctgaacgacgcgcgcttctac
agcctgttctacggcatcccggccttctgctacgggccgaaggcggaacaggtccatggc
ttcaacgagcgcgtggagatcgaatccatccgcggcaccaccaagagcatcgccgccttc
gtcgcaggctggtgcggcgtcgagcgcgcctga

DBGET integrated database retrieval system