KEGG   Roseomonas gilardii: RGI145_18700Help
Entry
RGI145_18700      CDS       T04615                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
rgi  Roseomonas gilardii
Pathway
rgi00061  Fatty acid biosynthesis
rgi00780  Biotin metabolism
rgi01100  Metabolic pathways
rgi01130  Biosynthesis of antibiotics
rgi01212  Fatty acid metabolism
Module
rgi_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:rgi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    RGI145_18700
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    RGI145_18700
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    RGI145_18700
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rgi01004]
    RGI145_18700
Enzymes [BR:rgi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     RGI145_18700
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     RGI145_18700
Lipid biosynthesis proteins [BR:rgi01004]
 Fatty acid synthase
  Component type
   RGI145_18700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: APT58837
UniProt: A0A1L7AJ73
LinkDB All DBs
Position
1:complement(4170701..4171480)
Genome map
AA seq 259 aa AA seqDB search
MIPRERVTLEGRRGLVTGIANDSSIAWGCARAFRGLGAELAVTYLNDKARPHVEPLAREL
EASILMPLDLERPGQLEAVFERIEQDWGQLDFLLHSIAFAPRKDLHGRVVDCSRDGFLRA
MDISCWSFLRMAKLAEPLMTRGGTLFCMSYYGSQRVVEHYNMMGPVKAALESATRYLAAE
LGPQGIRVHAVSPGPLKTRAASGINEFDEMLERAQSTAPARSLVSIEDVGLATAYLATDA
AKLITGQTLYIDGGYNIMG
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgatcccgcgcgagcgcgtcacgctggagggccggcgcggcctcgttaccggcatcgcc
aatgacagctccatcgcctggggctgcgcccgcgccttccgcggcctgggggcggaactc
gccgtcacctacctgaacgacaaggcgaggccgcatgtggagccgctggcgcgggagttg
gaagcgtccatcctcatgccgctggacctggagcggccgggccagctcgaagccgtcttc
gagcgcatcgaacaggactgggggcagctcgacttcctgctgcattccatcgccttcgcc
ccgcgcaaggacctgcatgggcgcgtggtggactgttcgcgcgacggcttcctgcgcgcc
atggacatctcctgctggtccttcctgcgcatggccaagctggcggagccgctgatgacg
cgcggcgggacgctcttctgcatgagctactacggctcgcagcgggtggtggagcactac
aacatgatggggccggtgaaggccgcgctggaaagcgccacgcgctacctcgccgccgaa
ctcggtccccagggcatccgcgtccacgccgtctcacccggcccgctcaagacccgcgcc
gcctccggcatcaacgagttcgacgagatgctggaacgcgcccagagcaccgcccccgcc
cgcagcctcgtttccatcgaggatgtcggcctcgccaccgcctatctcgccaccgatgcc
gcgaagctcatcaccgggcagacgctctatatcgacggcgggtacaacatcatgggctga

DBGET integrated database retrieval system