KEGG   Roseomonas gilardii: RGI145_19005Help
Entry
RGI145_19005      CDS       T04615                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
rgi  Roseomonas gilardii
Pathway
rgi00010  Glycolysis / Gluconeogenesis
rgi00620  Pyruvate metabolism
rgi01100  Metabolic pathways
rgi01110  Biosynthesis of secondary metabolites
rgi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rgi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RGI145_19005
   00620 Pyruvate metabolism
    RGI145_19005
Enzymes [BR:rgi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     RGI145_19005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: APT58885
UniProt: A0A1L7AJD1
LinkDB All DBs
Position
1:4236378..4237895
Genome map
AA seq 505 aa AA seqDB search
MTKLDALRVTDSPFKRRYGNFIGGQWVEPASGRTFANTSPVNGRILCEVARSDATDIDRA
LDAAHAAKDAWGRTSVAERAKLLNAIAQRMEDNLDLLARAETLDNGKPIRETTAADLPLA
IDHFRYFAGCIRAQEGTLSEIDHDTVAYHFHEPLGVVGQIIPWNFPILMACWKLAPALAA
GNCVVLKPAEQTPASILVLADLIADILPPGVLNIVNGFGLEAGKPLALSPRIAKIAFTGE
TTTGRLIMQYASQNLIPVTLELGGKSPNIFFQDVGAEDDDFLDKAIEGFVMFALNQGEVC
TCPSRALIHESLYDRFMEKALKRVGDIKQGDPLDPSTMIGAQASSEQLEKILSYIDIGKQ
EGAEVLIGGERNILSGDLAEGFYMKPTVFRGHNGMRVFQEEIFGPVVSVTTFKDDEEALS
IANDTLYGLGAGVWTRDVNRAYRFGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRETH
SMMLDHYQQTKNMLVSYSPKKLGFF
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagctcgacgccctgcgcgtgacggattccccgttcaagcgccgctacggcaac
ttcatcggcggccagtgggtcgaacccgccagcggccgcaccttcgccaacacctcgccc
gtcaacggccgcatcctctgcgaggtcgcgcgttccgacgccaccgacatcgaccgcgct
ctggatgccgcgcatgccgccaaggacgcctggggccgcaccagcgtcgccgagcgcgcg
aagctgctgaacgcgatcgcgcagcgtatggaggacaacctcgacctcctcgcccgcgcc
gagacgctcgacaacggcaagccgatccgcgagaccaccgccgccgacctgccgctcgcc
atcgaccatttccgctacttcgccggctgcatccgtgcgcaggaaggcacgctgagcgag
atcgaccacgacaccgtggcctatcacttccacgagccgctgggcgtcgtcggccagatc
atcccgtggaacttcccgatcctgatggcgtgctggaagctcgcccccgcgctcgccgcc
ggcaactgcgtggtgctgaagcccgccgagcagacgccggcctcgatcctcgtgctggcc
gacctgatcgccgacatcctgccgcccggcgtgctcaacatcgtcaacggcttcgggctg
gaggccggcaagccgctggcgctcagcccgcgcatcgccaagatcgccttcaccggcgaa
acgacgacgggccggctgatcatgcagtatgccagccagaacctgatccccgtcacgctg
gagctcggcggcaagtcgcccaacatcttcttccaggatgtcggcgccgaggatgacgac
ttcctcgacaaggcgatcgagggcttcgtgatgttcgcgctgaaccagggcgaggtctgc
acctgcccgtcccgcgcgctgatccatgagagcctctacgaccgcttcatggagaaggcg
ctgaagcgcgtcggggacatcaagcagggcgatccgctcgatccctccaccatgatcggc
gcccaggcctccagcgagcaactggagaagatcctgagctacatcgacatcggaaagcag
gaaggcgccgaggtgctgatcggcggcgagcgcaacatcctgtccggcgacctcgcggaa
ggcttctacatgaagcccaccgtcttccgcggccacaacggcatgcgcgtcttccaggag
gagatcttcggccccgtcgtgtccgtcaccaccttcaaggatgacgaggaggctctctcc
atcgccaacgacacgctctacggcctgggcgccggcgtctggacgcgggacgtgaaccgc
gcctaccgcttcggccgcgccatccaggccgggcgggtctggaccaactgctaccacgcc
tatccggcccatgcggccttcggcgggtacaagcaatcgggcatcgggcgcgagacgcac
agcatgatgctcgaccactaccagcagaccaagaacatgctggtcagctacagcccgaag
aagctcggcttcttctga

DBGET integrated database retrieval system