KEGG   Rhodanobacter glycinis: CS053_10560Help
Entry
CS053_10560       CDS       T06136                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
rgl  Rhodanobacter glycinis
Pathway
rgl00071  Fatty acid degradation
rgl00280  Valine, leucine and isoleucine degradation
rgl00281  Geraniol degradation
rgl00310  Lysine degradation
rgl00362  Benzoate degradation
rgl00380  Tryptophan metabolism
rgl00410  beta-Alanine metabolism
rgl00640  Propanoate metabolism
rgl00650  Butanoate metabolism
rgl00903  Limonene and pinene degradation
rgl00930  Caprolactam degradation
rgl01100  Metabolic pathways
rgl01110  Biosynthesis of secondary metabolites
rgl01120  Microbial metabolism in diverse environments
rgl01130  Biosynthesis of antibiotics
rgl01200  Carbon metabolism
rgl01212  Fatty acid metabolism
Module
rgl_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rgl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CS053_10560
   00650 Butanoate metabolism
    CS053_10560
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CS053_10560
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CS053_10560
   00310 Lysine degradation
    CS053_10560
   00380 Tryptophan metabolism
    CS053_10560
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CS053_10560
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CS053_10560
   00281 Geraniol degradation
    CS053_10560
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CS053_10560
   00930 Caprolactam degradation
    CS053_10560
Enzymes [BR:rgl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     CS053_10560
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CS053_10560
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     CS053_10560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 Pyr_redox_2 UDPG_MGDP_dh_N NAD_binding_2 ApbA AlaDh_PNT_C Pyr_redox
Motif
Other DBs
NCBI-ProteinID: QEE24896
UniProt: A0A5B9E3U4
LinkDB All DBs
Position
2421255..2423324
Genome map
AA seq 689 aa AA seqDB search
MFEGLRFNHWKTNLDDSGIVTLTLDRANSSVNAISREVLDELGQIVERLAIERPAGVIIH
SAKASGFAVGADIKEFVGYAKHGTVLENIQNGQRVYESLARLPCPTVAAVHGACMGGGTE
LILACRQRIAADDEKTRIGLPEVMLGIHPGWGGSARLPRLIGAPDALPVMLTGKPLSAKR
ALALGVVDRTARLDELLTEAKHLLRRPVTRPFVRRTKAWATNTWLARQILAPMVIKQTAA
KVRKEHYPAPFALIDVWKRGGGDIRQRLKLEALSVSKLAQTPTAQNLIRIFFLQERLKGA
GGGVDPAIKHVHVVGAGVMGGDIAAWAALKGFDVTLQDREMKYVQPALDRARKLYEKKLK
TPEKIEAATRRLRADVEGKGVADADLAIEAIYENAEAKEALYATIEPQFQADEILATNTS
SIPLDELRGKLTAPQRFLGLHFFNPVAQMPLVEVVRHERLDPAIEKRALAFCKAIGKLPV
AVKGTPGFLVNRILMPYLLEAMRLYNEGVPGPVLDKVATKFGMPMGPIELADTVGLDVCA
SVGKELAPFLGLELPPGLEDKMEAGKRGKKDGQGLYVWHEGKPQKPEVDPDYAASPDLQD
RMVLSMVNEAVACLADGVVDDADLLDAGVIFGTGFAPFRGGPIQYIRSEGAAKLKARLEA
LAAQYGERFTPKPGWDNPVLAQSGFELPD
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgttcgaaggactgcgcttcaaccattggaaaacgaacctggatgacagcggcatcgtc
acgctgaccctcgaccgcgccaacagcagcgtcaacgccatttcgcgcgaggtgctggac
gagctgggccagatcgtcgagcggctggcgatcgagcggccggccggggtgatcatccac
tccgccaaagcctccggcttcgccgtgggggccgacatcaaggagttcgtgggttacgcg
aagcacggcaccgtgctggagaacatccagaacggccagcgcgtctacgaatcgctggca
cgcctgccctgcccgaccgtggccgccgtgcacggcgcctgcatgggcggcggcaccgaa
ctgatcctggcctgtcgccaacgcatcgccgcggatgacgagaaaacccgaatcggcctg
cccgaagtcatgctcggcatccatcccggctggggcggcagcgcgcgcctgccacgcctg
atcggtgctcccgacgcgctgccggtgatgctcaccggcaagccactgtcggcaaagcgg
gcactggcgctcggcgtggtcgatcgcaccgcccggctcgacgagctgctgaccgaagcg
aagcatctgttgcgccgccccgtcacgcgcccgttcgtgcggcggaccaaggcctgggcc
acgaacacctggctggcgcggcagatcctcgccccgatggtgatcaagcagaccgccgcc
aaggtgcgcaaggaacactacccggccccattcgcgctgatcgacgtgtggaagcgcggc
ggcggcgacatccggcaacggctgaaactggaagcgctgtcggtgtccaagctggcgcag
acgccgaccgcgcagaacctgatccgcatcttcttcctgcaggagcgtctgaaaggcgcc
ggcggtggcgtcgaccccgccatcaagcacgtgcacgtggtcggtgccggcgtcatgggc
ggcgatatcgcggcctgggcagcgctgaagggtttcgacgtgaccctgcaggatcgcgag
atgaagtacgtccagcccgcgctggaccgcgcccgcaagctctacgagaaaaaactgaaa
acgccggaaaagatcgaggccgccacgcgtcgcctgcgcgccgatgtcgagggcaagggc
gtggccgatgccgacctggcgatcgaggcgatctacgagaacgcggaagccaaggaagcg
ctttacgccaccatcgaacctcagttccaggccgacgagatcctcgctaccaacacctcc
agcattccgctggatgaactgcgcggcaagctgacggcgccgcaacgtttcctcggcctg
cacttcttcaacccggtggcgcagatgccgctggttgaggtggtgcgccacgagcggctc
gatccggccatcgagaaacgcgcactggcgttctgcaaggccatcggcaagttgccggtg
gcggtcaagggcacgcccggcttcctggtcaatcgcatcctgatgccttacctgctcgaa
gccatgcgcctgtacaacgaaggcgtgcccgggccggtgctggacaaggtcgccacgaag
ttcggcatgccgatgggaccgatcgagctggccgacacggtcgggctggacgtgtgcgcc
tcggtcggcaaggaactggcacccttcctcggcctggagttgccccccggcctcgaagac
aaaatggaagctggcaagcgcggcaagaaggatggccagggcctgtacgtctggcacgaa
ggcaagccgcagaagcccgaggtcgatccggactacgccgcctcgcccgatctgcaggac
cgcatggtgctgtcgatggtcaacgaagccgtggcatgcctggccgacggcgtggtcgac
gatgccgacctgctcgatgccggggtgatcttcggtaccggcttcgcacccttccgcggt
ggcccgattcagtacatccgcagcgaaggcgcggccaagctcaaggcacgcctagaagcg
ctggcggcgcaatacggcgaacgcttcacgccgaagccgggctgggacaacccggtactg
gcgcaaagcggttttgaattgccggactga

DBGET integrated database retrieval system