KEGG   Rhodanobacter glycinis: CS053_12645Help
Entry
CS053_12645       CDS       T06136                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
rgl  Rhodanobacter glycinis
Brite
KEGG Orthology (KO) [BR:rgl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CS053_12645 (ahpF)
Enzymes [BR:rgl01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CS053_12645 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like AlaDh_PNT_C FAD_oxidored Glutaredoxin DAO NAD_binding_7 K_oxygenase FAD_binding_3 FMO-like Thi4 NAD_binding_8 Thioredoxin_4
Motif
Other DBs
NCBI-ProteinID: QEE25245
UniProt: A0A5B9E2P3
LinkDB All DBs
Position
2879328..2880914
Genome map
AA seq 528 aa AA seqDB search
MLDETLKTQLQAYLEKLVQPIELVAALDDGDKSRELDGLLHEIAALSDKISLRRDDSEAR
KPSFAINRLGTDISVRFAGIPMGHEFTSLVLALLQVGGHPSKAAAETIEQVRNLDGEFRF
ETYFSLSCQNCPDVVQALNLMSVLNPNIKHVAIDGALYQDEVESRQVMSVPTVYLNGEVF
DQGRMSLEQILAKIDTGSAAREAEKIKTKDAFDVLVVGGGPAGAAAAIYAARKGIRTGVA
AERFGGQVLDTMGIENFISVDYTEGPKLGAALEQHVHEYDVDVMNLQRATKLVPASESAS
GLVEVQLENGASLSAKTVILSTGARWRQMGVPGENEYRNKGVAYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVAHVTLVEFDSKLRADEVLQRKLRSLPNVDIIVSAQSTEVLGD
GQKVNGLVYKDRTDGVMHSVELEGIFVQIGLLPNTEWLKGALELSPRGEIVINDRGQTSL
PGVFAAGDATTVPYKQIVIAMGAGSTAALAAFDHLIRTSAPVAETATA
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgaaaccctcaaaacccaattgcaggcctatttggaaaagctggtgcagccg
atcgagctggtcgccgcactggatgatggcgacaagtcgcgcgaactggacggactgcta
cacgaaattgccgcgctgtcggacaagatcagcctgcgccgcgacgacagcgaagcgcgc
aagccctcgttcgccatcaaccgcctcggcaccgacatcagcgtgcgtttcgccggcatc
ccgatgggccacgagttcacctcgctggtactggccctgctgcaggtcggcgggcatccg
tccaaggcggcggccgagaccatcgaacaggtgcgcaatctggatggcgagttccgcttc
gaaacctatttctcgctgtcgtgccagaactgccccgacgtggtgcaggcgctgaacctg
atgagcgtgctcaatcccaacatcaagcacgtggccatcgacggcgcgctgtaccaggac
gaggtcgaatcccgccaggtgatgtcggtacccaccgtctacttgaacggcgaagtattc
gaccagggccgcatgagcctggagcagatcctggccaagatcgacaccggcagcgcggca
cgcgaagccgagaagatcaagaccaaggacgcgttcgacgtgctcgtcgtcggcggcggt
ccggccggcgcggccgcggcgatctacgccgcacgcaagggcatccgcaccggcgtggca
gccgagcgattcggcggccaggtgctcgataccatgggcatcgagaacttcatttcggtc
gactacaccgaaggccccaagctgggcgccgcgctggaacagcacgtgcacgaatacgac
gtggacgtgatgaacctgcagcgtgcgaccaagctggtgcccgccagcgaatcagccagc
ggcctggtcgaggtacaactcgaaaacggcgcgagcctcagcgcgaaaacggtgatcctc
tccaccggcgcgcgctggcggcagatgggcgtgcccggtgaaaacgaataccgcaacaag
ggcgtggcctattgcccgcactgcgacggcccgctgttcaagggcaagcgcgtggcagtg
atcggcggcggcaactccggcgtcgaggcggccatcgacctggccggcatcgtcgcccac
gtcaccctggtcgagttcgacagcaagctgcgcgcggacgaagtcctgcagcgcaagctg
cgcagcctgcccaacgtcgacatcatcgtcagcgcccagagcaccgaagtgctgggcgat
ggccagaaggtcaacggactggtctacaaggaccgcaccgatggcgtgatgcacagcgtg
gaactggaaggcatcttcgtgcaaatcggcctgttgccgaacaccgaatggctgaagggc
gcgctggagctgtcgccacgcggcgaaatcgtgatcaacgatcgcggccagacatcgcta
cccggcgtgttcgccgccggtgacgccaccaccgtaccgtacaagcagatcgtgattgcg
atgggcgccggctccaccgctgcactggccgcgttcgatcatctgatccgcacgtcggct
ccggtggcagagaccgctacggcctga

DBGET integrated database retrieval system